KEGG   Hydrogenophaga sp. RAC07: BSY239_1287Help
Entry
BSY239_1287       CDS       T04455                                 

Gene name
bchL
Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00860  Porphyrin and chlorophyll metabolism
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSY239_1287 (bchL)
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     BSY239_1287 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 SRP54 MipZ AAA_26 AAA_10 CBP_BcsQ ABC_tran NB-ARC AAA_25 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AOF87474
UniProt: A0A1B3M2Z3
LinkDB All DBs
Position
1367865..1368785
Genome map
AA seq 306 aa AA seqDB search
MMETSVPLTDLRRASGRSSREDGEGSLQVQLDPSLKIGNAKVFAIYGKGGIGKSTTSSNL
SAAFSHLGKRVLQIGCDPKHDSTFTLTKKMLPTVIDVLETVDFHAEELRVEDFVFPGYNG
VMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHAD
RALIVTANDFDSIFAMNRIVQAIGAKAKNYNVRLGGVIANRSSATDQIDKYNNQIGLKLA
AHFPDLDVIRRSRLKKSTLFEMETSPELEAVKKEYMRLAASLWLGVEPLAAVPMKDRDIF
DLLGFD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaccagcgttcccctgaccgacctgaggcgtgcctccggccgatccagccgt
gaagacggggagggcagccttcaggtccagctcgacccctcgctcaagatcggcaatgcc
aaggtctttgccatctatggcaagggcggcatcggcaagagcaccaccagctccaacctg
tcggccgcgttttcccacctgggcaaacgcgtgctgcagatcggctgcgaccccaagcac
gacagcaccttcaccctgacgaagaagatgctgcccacggtgatcgacgtgctggagacg
gtggacttccacgccgaggaattgcgcgtggaagacttcgtgttccccggctacaacggc
gtgatgtgtgtcgaagccggcggcccgcccgccggcaccggctgtggcggttacgtggtc
ggccagaccgtgaaactgctgaaggagcaccacctgctcgaagacaccgacgtggtgatc
ttcgacgtgctgggcgacgtggtgtgtggtggcttcgccgccccgctgcagcacgccgac
cgcgcgctcatcgtcaccgccaacgacttcgactcgatcttcgcgatgaaccgcatcgtg
caggccatcggtgccaaggcgaagaactacaacgtgcgcctgggaggcgtgatcgccaac
cgcagttcggccaccgaccagatcgacaagtacaacaaccagatcggcctgaagctcgcc
gcgcacttccccgacctggacgtgatccgccgcagccgcctcaagaagagcaccttgttc
gagatggaaacctcgcccgaactcgaagcggtgaaaaaggaatacatgcgcctggccgcg
tcgctctggctgggggtggagccgctggcggccgtgcccatgaaggaccgcgacatcttc
gacctgctcgggttcgactga

DBGET integrated database retrieval system