KEGG   Hydrogenophaga sp. RAC07: BSY239_1769Help
Entry
BSY239_1769       CDS       T04455                                 

Definition
(GenBank) DNA polymerase III chi subunit, HolC family protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr03030  DNA replication
hyr03430  Mismatch repair
hyr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSY239_1769
   03430 Mismatch repair
    BSY239_1769
   03440 Homologous recombination
    BSY239_1769
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hyr03032]
    BSY239_1769
   03400 DNA repair and recombination proteins [BR:hyr03400]
    BSY239_1769
Enzymes [BR:hyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSY239_1769
DNA replication proteins [BR:hyr03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BSY239_1769
DNA repair and recombination proteins [BR:hyr03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BSY239_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AOF87033
UniProt: A0A1B3M1P8
LinkDB All DBs
Position
complement(1870197..1870631)
Genome map
AA seq 144 aa AA seqDB search
MPDVAFHFNAPDRVGYACRLLRKAYLRNARLFVWVTEGDLARLDTALWTMGAGEFVPHCR
SDDPETVTARSPIQIGHQLPGQRGDLVLVNLHHDMPDDPVAFKRVIEVVTLDEADRAAAR
ERWRQYRALGLEPQRHDLQLVPSD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacgtcgcttttcacttcaacgcgcccgaccgggtgggctatgcctgtcgcttg
ctgcgcaaggcctacttgcgaaacgcgcgtctgttcgtgtgggtgactgaaggcgatctc
gcccggctcgacacagcgctgtggaccatgggcgcgggcgagttcgtgccccattgccgc
agcgacgaccccgagaccgtgaccgcacggtcgcccatccagattggtcaccaactgccc
gggcaacgcggtgacctggttctggtgaacctgcatcacgacatgcccgacgaccccgtt
gccttcaagcgggtgatcgaggtcgtgacgctggacgaggcagaccgcgccgcagcacgc
gagcgatggcgccaatacagggcgcttggcctggagccgcagcgccacgacctccaattg
gtgccttcggattga

DBGET integrated database retrieval system