KEGG   Hydrogenophaga sp. RAC07: BSY239_1883Help
Entry
BSY239_1883       CDS       T04455                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00071  Fatty acid degradation
hyr00280  Valine, leucine and isoleucine degradation
hyr00281  Geraniol degradation
hyr00310  Lysine degradation
hyr00362  Benzoate degradation
hyr00380  Tryptophan metabolism
hyr00410  beta-Alanine metabolism
hyr00640  Propanoate metabolism
hyr00650  Butanoate metabolism
hyr00903  Limonene and pinene degradation
hyr00930  Caprolactam degradation
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
hyr01120  Microbial metabolism in diverse environments
hyr01130  Biosynthesis of antibiotics
hyr01200  Carbon metabolism
hyr01212  Fatty acid metabolism
Module
hyr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSY239_1883
   00650 Butanoate metabolism
    BSY239_1883
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY239_1883
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY239_1883
   00310 Lysine degradation
    BSY239_1883
   00380 Tryptophan metabolism
    BSY239_1883
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSY239_1883
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSY239_1883
   00281 Geraniol degradation
    BSY239_1883
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY239_1883
   00930 Caprolactam degradation
    BSY239_1883
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BSY239_1883
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSY239_1883
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BSY239_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AOF87808
UniProt: A0A1B3M3W9
LinkDB All DBs
Position
1992330..1994486
Genome map
AA seq 718 aa AA seqDB search
MKTIRYELHDGIATLTFDEPGSPVNTMCADWQRDLSTATGLVVRDKGLIEGIVLASAKST
FFAGADLKSTMRLTPADAPRVFAEIEQTKKNFRTLETLGVPVVSCINGAALGGGWEVALV
GHHRVAVDNPKIQLGLPEITLGLIPGATGITKMTRLLGLMGAQPYILESKLFNPREALDL
GLVHALVPANGDDVAASLRTAALLWIAANPQAQHPWDAKDYKIPGGTPANPKIAGMLTVA
PAMLKQKTRGLYPAPEAALAAMAEGAMVDYDTATRIESRYLAKLIVSPVARNMINTFFFN
MNAIKSGQSRPKDVPRYKPKKVGILGAGMMGAGIAYVQASRGIETVLEDVSLENAQRGKA
YSAKLTQPRVDKARMSPHDQQALLERITPTAHPADLQGCDLIIEAVFENRELKAAVTREA
EPMLAEGGFFASNTSTLPISGLAQASTHPAKFIGIHFFSPVDKMKLVEIIRGKETDDETV
ARAYDYVQALGKLPIVVNDSRGFYTSRTFGTFVMEGAAMLGEGIPAPVIENASMQAGMPV
GPLAVLDETALSLSVHVLDQTRDDFQSEGKTYEATPGELLVERMVKELHRAGRAAGGGFY
DYPAGQKKALWPELKPLFEKPGHAWELQEVKDRLLYRQAVETARCLAEGVLTSVHDGNIG
SIFGIGFPAWTGGALQFIYGMGIDAFEARCAQLAHKFGPGFALSEVVKRTIRHHQPVY
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatccgctacgaactgcacgacggcattgccaccctcaccttcgacgagccc
ggctccccggtgaacaccatgtgcgccgactggcagcgcgacctgagcactgccaccggc
ctggtggtgcgcgacaaaggtttgatcgagggcatcgtcctggcctcagccaagagcacc
ttcttcgccggcgccgacctcaagagcaccatgcgcctcacgccggccgatgcgccgcgc
gttttcgccgagatcgagcagaccaagaaaaacttccgcacgctggaaaccctgggtgtg
cccgtggtgagctgcatcaacggcgcagctctgggcggcggctgggaagtggcgctggtg
ggtcaccaccgcgtcgcggtggacaaccccaagatccagctgggcctgcccgaaatcacg
ctggggttgatccccggcgccaccggcatcaccaagatgacgcgtcttctgggattgatg
ggcgcgcagccctacatcctggagagcaagctgttcaacccgcgcgaggcactcgacctc
ggcctggtgcacgcgctggtgccggccaatggcgacgacgtggcggcctcgttgcgcacc
gcggcgttgttgtggatcgcggccaacccccaagcccagcacccctgggacgccaaggac
tacaagatcccgggcggcacaccggccaaccccaagatcgccggcatgttgaccgtggcg
ccggccatgctcaagcagaaaacgcgcggcctgtaccctgcccccgaagccgcgctggcg
gccatggccgagggcgcgatggtggactacgacacagccacgcggatcgaaagccgctac
ctcgccaagctcatcgtgagcccggtggcgcgcaacatgatcaacacgttcttcttcaac
atgaacgcgatcaaaagcgggcagtcgcgcccgaaagacgtgccgcgctacaagccgaaa
aaggtcggcatcctcggcgccggcatgatgggcgcgggcatcgcctacgtccaggccagc
cgcggcatcgagaccgtgctggaagacgtgagcctggagaacgcgcagcgcggcaaggcc
tacagcgccaagctcacccagccacgcgtcgacaaagcgcgcatgagtccgcacgaccag
caggcgctgctggagcgcatcacgcccaccgcgcacccggccgatctgcaaggctgcgac
ctgatcatcgaggccgtgttcgagaaccgcgagctcaaggctgcggtgacgcgcgaggcc
gagcccatgctggccgaaggcggcttctttgccagcaacacgtccaccctgcccatctcc
ggcctggcgcaggccagcacccacccggccaagttcatcggcatccacttcttcagcccg
gtggacaagatgaagctggtggagatcatccgcggcaaggaaacggacgacgaaacggtg
gctcgcgcgtacgactacgtgcaggcgcttggcaagctgccgattgtggtgaacgactcg
cgcggtttctacaccagccgcacgtttggcaccttcgtgatggaaggcgcggcgatgctg
ggcgaaggcatccccgctcccgtgatcgaaaacgcctccatgcaggccggcatgccggtg
ggaccgctggccgtgctggacgaaaccgcgctgtcgctctcggtccacgtgctggaccag
acccgcgatgacttccagtccgagggcaagacctatgaggccacgccaggcgagctgctg
gtcgagcgcatggtgaaggagctccaccgcgctggccgggcggccggcgggggcttttac
gactacccggccgggcagaagaaagcgctgtggcccgagctcaaacccctgtttgagaaa
cccggacacgcctgggagctgcaggaggtgaaagaccgcctgctctaccgccaggcggtg
gagaccgcgcgctgcctggccgaaggcgtgctcaccagcgtgcacgacggcaacatcggc
tccatcttcggcatcggctttccggcctggaccgggggcgcgctgcagttcatctacggc
atgggcatcgacgcgttcgaagcgcgctgcgcccagctggctcacaagttcggtcccggg
tttgcgctcagcgaagtcgtgaaacgcaccatccgccaccaccaacccgtctactga

DBGET integrated database retrieval system