KEGG   Hydrogenophaga sp. RAC07: BSY239_2083Help
Entry
BSY239_2083       CDS       T04455                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY239_2083 (ahpF)
Enzymes [BR:hyr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSY239_2083 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Thi4 Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 AlaDh_PNT_C G3P_acyltransf
Motif
Other DBs
NCBI-ProteinID: AOF85862
UniProt: A0A1B3LYC6
LinkDB All DBs
Position
complement(2203483..2205075)
Genome map
AA seq 530 aa AA seqDB search
MLDTNLKTQLQAYLGKLQRPIRLIASLDASAGAAEMKELLQEVAGLSDLVSFDESGTDAR
KPSFVIARDGESTGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEAAVIDQIKGLEGDFNF
EMYMSLSCHNCPDVVQALTLMSILNPAVKATVIDGGLYQAEVEERQILAVPMVFLNGELF
GSGRMLLEEIVAKLDVKSDEREAAKLNAKDPYDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQTNDTMAIENYISVLETDGPKFAAALEAQVRHYDVDIMNLQRADKIIPAKEAGG
LVQVQMANGAVLHSRSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKDVAVI
GGGNSGVEAAIDLAGIVKHVTLVEFADALKADAVLVSKLKSLPNVTINVNAQTTEITGAG
GKVNGMSFKDRVSGEVKHVALEGVFVQIGLVPNTEWLKGTVDLSRYGEIEIDAKGHTNVP
GVFAAGDCTTVPYKQIVIAAGDGSKAALSAFDYLIRQPVVAARAEEAVAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacctcaagacgcaactgcaggcttacctcggcaagctgcagcgtccg
atccgtttgatcgcttcgctggacgccagcgccggcgcggccgagatgaaggagttgctg
caggaagttgccgggctgtccgacctggtgagcttcgacgagagcggcaccgatgcgcgc
aagccttcgtttgtgattgcccgcgacggtgaatccaccggcgtgcgttttgcggccatt
ccgctgggtcacgagttcacctcgctggtgctggctctgctgtggacgggtggccatccg
cccaaggtcgaggccgccgtgatcgatcaaatcaagggcctggaaggcgacttcaacttc
gagatgtacatgagcctctcgtgccacaactgcccggacgtggtgcaggcgctcacgctg
atgtccatcctcaacccggccgtgaaagccaccgtcatcgacggtggtctctaccaggcc
gaggtggaagagcgccagatcctggccgtgcccatggtcttcctcaatggtgagctgttc
ggctcgggccgcatgctgctcgaagagatcgtggccaagctggacgtgaagtccgacgag
cgcgaagccgccaagctcaacgccaaggacccctacgacgtgttgatcgtcggcggtggc
ccggcgggtgctgctgcggccgtgtacgccgcccgcaagggcatccgcgtgggtgtggcc
gccgagcgcttcggtggccagaccaacgacaccatggcgatcgagaactacatcagcgtg
ctggaaaccgacggccccaaattcgccgccgcgctcgaagcgcaggtgcgccactacgac
gtggacatcatgaacctgcagcgcgccgacaagatcattccggccaaggaagcgggcggt
ctggtgcaggtgcagatggccaatggcgcggtgctgcattcgcgcagcgtgatcctgtcc
accggtgcgcgctggcgcaacgtgaacgtgcccggcgaggccgagtacaagaacaagggc
gtggcctactgcccgcactgcgacggccccctcttcaagggcaaggacgtggcggtgatc
ggtggtggcaactccggcgtggaggccgcgatcgacctggccggcatcgtgaagcacgtg
acgctggtcgagtttgccgacgcgctcaaggccgatgcggtgctggtgagcaagctcaaa
agcctgcccaacgtgaccatcaacgtgaatgcgcagacgactgagatcacgggcgctggc
ggcaaggtcaacggcatgagtttcaaggaccgtgtgagtggcgaggtgaaacacgtcgcg
ctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcaagggcacc
gtggacctgagccgctacggcgagatcgagatcgacgccaagggccacaccaacgtgccc
ggcgtgtttgctgcgggtgactgcaccaccgtgccgtacaagcagatcgtgatcgccgcg
ggtgatggttccaaggccgcgctcagcgccttcgactacctgatccgccagccggtggtg
gctgcaagagccgaagaggctgtcgcggcctga

DBGET integrated database retrieval system