KEGG   Hydrogenophaga sp. RAC07: BSY239_3102Help
Entry
BSY239_3102       CDS       T04455                                 

Definition
(GenBank) AAA domain protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hyr01100  Metabolic pathways
hyr01110  Biosynthesis of secondary metabolites
hyr01130  Biosynthesis of antibiotics
hyr01230  Biosynthesis of amino acids
Module
hyr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSY239_3102
Enzymes [BR:hyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSY239_3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_17 AAA_33 Cytidylate_kin2 AAA_16 AAA_22 Cytidylate_kin Viral_helicase1 AAA_5 FtsK_gamma AAA KTI12 AAA_24 Ploopntkinase3 AAA_25
Motif
Other DBs
NCBI-ProteinID: AOF84416
UniProt: A0A1B3LU92
LinkDB All DBs
Position
complement(3264408..3264959)
Genome map
AA seq 183 aa AA seqDB search
MSATSCFLIGLPGSGKSTVGRQLARRIDLPFFDSDHVIEQRLGCSIREFFEREGEDRFRD
IESAILDELTAGPACVVSTGGGSVLRNENREHLHQRGSVVYLRSTPEEVFRRLRYDRNRP
LLQVADPLQRLKDLYSVRDPLYRETAHFVIETGRPSVAMLVNMIVMQLELAGVVAPGAVP
PQH
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgccacctcctgtttcctgatcggcttgcccggctcgggcaagtcgacggtgggt
aggcagctggcccgccgcatcgatctccccttttttgactccgaccacgtgatcgaacag
cgattgggctgttcgatccgcgagtttttcgagcgcgaaggggaagaccgctttcgagac
atcgagtcggcgatcctggacgaactcaccgccgggcctgcctgtgtggtgtccaccggt
ggtggatctgtgttgcgcaacgagaaccgggaacacctccaccagcgcggctccgttgtg
tacctccgctcgacgcccgaagaggtgttccgtcggctgcgatacgaccgcaaccgtccc
ctgctgcaggtggcagaccccttgcagcgactgaaagatctctattcggtgcgtgatcct
ctgtaccgggagacagcgcatttcgtgattgagaccggcaggccttcggtggccatgctg
gtgaacatgatcgtgatgcagctggagcttgccggcgtggtggcgcccggcgcagtgcca
ccccagcactga

DBGET integrated database retrieval system