KEGG   Hydrogenophaga sp. RAC07: BSY239_3935Help
Entry
BSY239_3935       CDS       T04455                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSY239_3935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AOF86051
UniProt: A0A1B3LYW5
LinkDB All DBs
Position
complement(4169711..4170472)
Genome map
AA seq 253 aa AA seqDB search
MELLLVSLASFFAGFVDSIVGGGGLILVPALFAMFPTTHPATLFGVNKGASVWGTAAATL
QYARRVKMPWHALLPAAAVGFAGSMAGAWTVTVISPDFLRRALPLVLMGVLAYTLARKDL
GRHHAPRFSGRREAAAACVLALIIGFYDGFFGPGTGSFFVFLFVRWLGYDFLHASASAKL
INTATNLAALMLFAWKGHVWWHFVLAMAIANVVGSLLGTRLALKHGSGFVRIAFIVVVSA
LILKTTFDAWIRG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaattgctgcttgtttcgctggcctcgtttttcgccggcttcgtggattcgatcgtg
ggcggcggtggcctcatcctggtgcccgcgttgttcgccatgtttcccaccacccacccg
gccacgctgttcggcgtgaacaagggcgcgtcggtgtggggcacagcggcggccaccctg
cagtacgcgcggcgcgtcaagatgccgtggcacgcgctcctgccggcggcggccgtgggc
tttgccggctcgatggccggcgcctggaccgtgacggtgatatcgcccgactttttgcgc
cgcgccttgcccctggtgttgatgggtgtgctggcctacacgctggcgcgcaaggacctg
ggccgccaccacgccccgcgcttcagcggccggcgggaagccgccgccgcctgtgtgctc
gctttgatcatcggcttttacgacggcttcttcggcccgggcaccggcagcttcttcgtg
ttcctgttcgtgcgctggctgggttacgacttcctgcacgccagcgccagcgcgaagctc
atcaacaccgccaccaacctcgcggccctgatgctgtttgcctggaaaggccatgtgtgg
tggcacttcgtgctggcgatggccatcgccaacgtggtgggcagcctgctgggcacgcgc
ctggcgctcaagcacggcagcggctttgtgcgcatcgccttcatcgtggtggtgtcggcg
ctgatcctgaaaacgacctttgatgcgtggatcagggggtga

DBGET integrated database retrieval system