KEGG   Hydrogenophaga sp. RAC07: BSY239_777Help
Entry
BSY239_777        CDS       T04455                                 

Gene name
cbxSC
Definition
(GenBank) ribulose bisphosphate carboxylase small chain, chromosomal
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
hyr00630  Glyoxylate and dicarboxylate metabolism
hyr01100  Metabolic pathways
hyr01120  Microbial metabolism in diverse environments
hyr01200  Carbon metabolism
Module
hyr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hyr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
hyr_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:hyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSY239_777 (cbxSC)
Enzymes [BR:hyr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BSY239_777 (cbxSC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AOF87281
UniProt: A0A1B3M2F9
LinkDB All DBs
Position
824179..824613
Genome map
AA seq 144 aa AA seqDB search
MMTNHGNRLTQGQFSFLPPLTDAQIGSQIEYALKNNYAVGVEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILMEINNCRRTFPQHYIRVTAFDSTQGVESPRMSFIVNRPAREPGFGLART
EVEGRQVRYRISSYATDKPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaccacggcaaccgcctgacgcagggccagttttccttcctgccccccctc
accgacgcacagatcggcagtcagatcgagtacgcgctgaaaaacaactacgcggtgggc
gtcgagtacaccgacgacccgcacccgcgcaacacctactgggagatgttcggcaacccg
atgttcgacctgaaggacccggccggtatcctgatggagatcaacaactgccgcagaacc
tttccgcagcactacatccgcgtcacggcgttcgattcgacgcagggcgtggagtcgccg
cgcatgtcgttcatcgtcaaccggcccgccagggagccaggcttcggactcgcacgcacc
gaggtggaaggtcggcaggtgcgctatcgcatcagctcgtacgcgaccgacaagcccgaa
ggcgagcgttattag

DBGET integrated database retrieval system