KEGG   Hydrogenobaculum sp. SN: HydSN_0864Help
Entry
HydSN_0864        CDS       T02516                                 

Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hys  Hydrogenobaculum sp. SN
Brite
KEGG Orthology (KO) [BR:hys00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HydSN_0864
Enzymes [BR:hys01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HydSN_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 FAD_oxidored HI0933_like GIDA NAD_binding_8 Thi4 FAD_binding_3 NAD_binding_7 DAO Trp_halogenase K_oxygenase TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGH93459
LinkDB All DBs
Position
783272..784210
Genome map
AA seq 312 aa AA seqDB search
MNKQLVIIGGGPSGVAASIYAARKKMDFVLVTKDIGGQILTSGDIENYMGFKNIDGISFV
QRLVEQLEYLEVSPLYAEVIDFKALKEHDFSISLSNELTIKAENVLICTGADHKKLGVKG
EQEGIGKGVSYCYTCDAPFYKNKKVIVVGGGNSGFEAAEQLANYASSITIIEYTDRFKAD
ETIQNKVLKNEKVKALTNHRVLEIYVDKNIGVTGVKLEDMKNGKTYDFETDGVFVEIGTK
PNTELFINTGIKLNKWGEIIIDQNNRTSLLGAYAAGDCTNIFAKQIITAAGEGAKALLSI
YHDITYGVSSSI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacagcttgtgataataggtggagggccatctggtgttgcagcttccatatac
gcagctagaaagaagatggattttgtgcttgttacaaaggacataggtggtcagatattg
acctctggggatatagaaaattatatgggctttaaaaatatagacggtattagctttgta
caaagacttgtagaacaacttgaatatttggaagtatctcctttgtacgctgaggtaatt
gattttaaagctttaaaagaacatgatttttctatatctttatcaaatgagctcacaata
aaagctgaaaacgttttaatatgcaccggcgctgatcataaaaagcttggtgtaaaaggt
gagcaagaggggataggcaaaggtgtatcttattgttatacctgtgatgcacctttttac
aaaaacaaaaaagttatagtagtgggtggtggtaattctggatttgaggccgcagagcaa
cttgcaaattacgcatcttctataacgataattgaatatacagatagatttaaagctgac
gaaaccattcaaaacaaagttttaaaaaatgagaaggtaaaagccctaacaaaccataga
gtgcttgagatatacgtagataaaaatataggcgtaacaggtgttaaattagaggatatg
aaaaacggcaaaacatacgattttgaaactgatggtgtttttgtagaaatcggtacaaag
ccaaacaccgagcttttcataaacactggtataaagctaaacaaatggggtgagataatc
atagatcaaaacaatagaacgtctttgcttggggcttatgcagcaggagattgtaccaac
atatttgcaaagcagataataaccgctgccggcgaaggggcaaaggctcttcttagtatt
tatcacgatattacatatggtgtaagttcgtcgatatga

DBGET integrated database retrieval system