KEGG   Hydrogenobaculum sp. SN: HydSN_1609Help
Entry
HydSN_1609        CDS       T02516                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hys  Hydrogenobaculum sp. SN
Pathway
hys00061  Fatty acid biosynthesis
hys00780  Biotin metabolism
hys01100  Metabolic pathways
hys01130  Biosynthesis of antibiotics
hys01212  Fatty acid metabolism
Module
hys_M00083  Fatty acid biosynthesis, elongation
hys_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hys00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HydSN_1609
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HydSN_1609
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HydSN_1609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hys01004]
    HydSN_1609
Enzymes [BR:hys01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HydSN_1609
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HydSN_1609
Lipid biosynthesis proteins [BR:hys01004]
 Fatty acid synthase
  Component type
   HydSN_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: AGH94170
LinkDB All DBs
Position
complement(1498733..1499515)
Genome map
AA seq 260 aa AA seqDB search
MILKGKKALIMGLANDKSIAYGIAKSFKREGADIAISYAGESVKKRVMPIAQELGTELVF
ECDVSKDQDIENLASNIKEAWNNIDIVVHSIAYAPKDEFKNGVIDTTRSGFNIAMDISVY
SFIAVVRAFSNIMNEEGAFLTLSYYGAQKVVPHYNVMGIAKAALESATRYLAFDVAKKNQ
RVNCISAGPIKTLSAYSITGFHILMEHTVKVSPLGRHVTIEEVGDTAAFLCSEWARGITG
QTIYVDSGYSIMGVSDKEEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaaaggtaaaaaagctcttataatgggtttagcaaacgataagagtatagcc
tatggtatagctaaaagcttcaaaagagaaggagctgatatagctataagctacgccggt
gaatctgtgaaaaaaagagtgatgcctatagcccaggagcttggcactgagcttgttttt
gaatgcgatgtatccaaagaccaagacatagaaaacctagcaagcaacataaaagaagct
tggaacaacatagacatagtagtgcattctatagcctatgctccaaaagatgagtttaaa
aatggtgttatagataccacaaggtctggttttaacatagccatggatatatccgtttat
tcgttcatagctgtagttagggcattctcaaacatcatgaacgaagaaggggcgtttttg
acgctttcttactacggagcccaaaaggtagtacctcattacaacgttatgggtatagca
aaagcagctttagaaagcgccacaaggtatttggcttttgatgtagcaaagaaaaatcaa
agggtaaattgcatatcagcaggtcccatcaaaacactatctgcatatagcataactggt
tttcatatactgatggagcacaccgttaaagtaagcccccttggaagacatgtcaccata
gaagaagtaggtgatacagctgcattcttatgtagtgaatgggcaaggggcatcacaggt
caaaccatatatgtagatagtggttatagtataatgggtgtttctgataaagaagaggag
taa

DBGET integrated database retrieval system