KEGG   Hymenobacter sp. PAMC 26628: AXW84_08695Help
Entry
AXW84_08695       CDS       T04961                                 

Definition
(GenBank) ferredoxin
Organism
hyz  Hymenobacter sp. PAMC 26628
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4 Fer4_2 Fer4_8 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_3 Fer4_6 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AMJ65498
UniProt: A0A126P9G2
LinkDB All DBs
Position
1970430..1970780
Genome map
AA seq 116 aa AA seqDB search
MAIMITDECINCGACEPECPNNAIYEGGAQWRWADGTTLKQVETADGTTVAGTAPQTPVS
DEYYYIVSDKCTECVGFHEEPQCAAVCPVDCCVDDPDLRETHERLLEKKAWLHLAA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggccatcatgataaccgacgagtgcatcaactgcggtgcctgcgagccggaatgcccc
aacaacgccatctacgaaggcggcgcgcagtggcgctgggccgacggtaccaccctgaag
caagtcgaaaccgccgacggcaccaccgtagccggcaccgcgccccaaacgccggtgtcg
gacgaatactactacatcgtctcggataagtgcacagagtgcgtcggcttccatgaggag
ccgcagtgcgccgccgtgtgccccgtcgattgctgcgtggacgaccccgacctgcgcgaa
acccacgagcggctgctcgaaaagaaagcctggctgcacctggccgcgtaa

DBGET integrated database retrieval system