KEGG   Hymenobacter sp. PAMC 26628: AXW84_19835Help
Entry
AXW84_19835       CDS       T04961                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
hyz  Hymenobacter sp. PAMC 26628
Pathway
hyz00380  Tryptophan metabolism
hyz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hyz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AXW84_19835
Enzymes [BR:hyz01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AXW84_19835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMJ67422
UniProt: A0A126PHA9
LinkDB All DBs
Position
complement(4576103..4577386)
Genome map
AA seq 427 aa AA seqDB search
MSSALLDPTHAAALDAADPLAAFRSEFLFPNGPDGQPVAYFCGNSLGLQPKATRAALDAE
LTNWAELAVEGHFHGAAPWMHSHGALAEASAPVVGALPHEVVIMNGLSVNLHLLLVSFYR
PTATRYKVLMEGGAFPSDQYALETQARLHGLDPDDAIVELVPRPGEHTLRTEDITAKIAE
LGDSLATVLLGGLNYYTGQVFDMAAVTAAGHAVGATVGFDLAHAAGNVPLHLHDWDVDFA
CWCTYKYLNSGPGGIAGAYVHERFANRPDLLRLAGWWGQEPAERFQMKKGFRPTPGADGW
LLSNSPVLLLAPLRASLDVVARAGGMAALRAKSEPLTAYLESLIRALALPADQLEIITPA
DPAQRGCQLSVLVHRRGRELFDYLAARGVVADWREPNVIRLSPVPLYNSFEDVRRAGTAM
HDFFAAG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgcgctcctcgaccccacccacgccgccgccctcgacgcggccgacccgctg
gctgcttttcgctccgaattcctgtttcccaacgggcccgacggccagccggtggcctac
ttctgcggcaactcgctgggcttgcagcccaaggccacccgcgccgccctcgacgccgag
ctgaccaactgggccgagctggccgtggagggccacttccacggtgccgcgccctggatg
cactcccacggggccctggccgaggccagcgcgccggtggtgggggccctgccgcacgaa
gtggtgattatgaacggcctgagcgtgaacctgcacctgctgctggtatcgttctaccgc
cccaccgccacccgctataaggtattgatggaaggcggcgccttcccctccgaccagtac
gccctcgaaacccaggcccgcttgcacggcctcgaccccgacgacgccattgtggagctg
gtgccccgccccggcgagcacacgctgcgcacagaagatattaccgccaaaattgccgag
ttgggcgactcgctcgccaccgtgctgctggggggcctcaactactacaccgggcaggta
ttcgacatggccgccgtcacggccgccgggcacgcggtaggcgccaccgtgggcttcgac
ctggcccacgccgccggtaacgtgccgctgcacctgcacgattgggacgtggactttgct
tgctggtgcacctacaagtacctcaactcggggcccggcggcattgcgggggcctacgtg
cacgagcggtttgcgaaccggcccgacctgctgcgcctcgccggctggtggggccaggag
ccggccgagcggtttcagatgaaaaaaggcttccgccccacgccgggcgccgacggctgg
ctgctgtcgaactcgccggtgctgctgctggccccgttgcgcgccagcctcgacgtggtg
gcccgcgccgggggcatggccgcgctgcgcgccaaaagcgagccgctcaccgcctacctc
gaaagcctgattagggccctggccttgcccgccgaccagctcgaaatcatcacccccgcc
gaccctgcccagcgcggttgccagctttcggtgctggtgcaccggcgcgggcgcgagctg
ttcgactacctggccgcccggggcgtggtggccgactggcgcgaaccgaatgtgattcgc
ctttcgcccgtgccgctctataattcgtttgaggacgtgcggcgggccgggacggcaatg
cacgatttttttgccgccggctag

DBGET integrated database retrieval system