KEGG   Ignisphaera aggregans: Igag_0313Help
Entry
Igag_0313         CDS       T01307                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
iag  Ignisphaera aggregans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox 2-Hacid_dh_C TrkA_N Sacchrp_dh_NADP UDPG_MGDP_dh_N NADH_4Fe-4S Pyr_redox_2 ThiF ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ADM27159
UniProt: E0SQT5
LinkDB All DBs
Position
complement(273427..274449)
Genome map
AA seq 340 aa AA seqDB search
MSIMKALVIIEPRKAEVRDVDIPEPRDNEVLVRVRACGLCQTDRHIYEGEFLAKYPIIPG
HEFSGEVIDTGKNVDMVRKGDRVVIDPNISCGRCYYCRSGMKHLCENWQGIGVTLNGGFA
EYALVPQENVYIMPRDLSFEAASLTEPLACIIHGIDRIGMAIGKTIAIFGAGPIGLMFLQ
LLRHFGASKIVVFDINDYRLEVAKKLSADYVYNPRDIDISKAIIDEVNRYGIDIVVEASG
SLEAFKQALKIVGYSGRILVFGVPPRESEVGIRLFDVYRKEISIIGSFVNPYTMYRALDI
LRANIISVNDIITHRVSLMEILDILKGNIPRNAIKIVSVF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtattatgaaggcattagtaataatagagcctcgtaaggcagaggtgagagatgta
gatatacctgagcctagagataatgaggttttagttagggttagagcctgtggactatgt
caaactgatagacatatatatgaaggtgaatttctagctaaataccctataatacctggc
catgagttttctggagaggttatagatacaggtaaaaatgttgatatggttagaaaagga
gatagagttgttatagatccaaatatatcgtgtggaagatgctactactgtagatctgga
atgaagcacctctgtgaaaattggcagggaattggtgttacactcaatggtggatttgca
gaatatgctctagttccacaggaaaatgtctatataatgccgagagatctatcatttgaa
gctgcatcgcttacagagccacttgcatgtataattcatggaattgatagaattggtatg
gctataggaaaaactatagctatctttggtgcaggccctataggtcttatgtttctacag
ctccttagacattttggagcttcaaaaatagttgtatttgatatcaatgactatagactt
gaggttgctaagaaacttagtgctgattatgtctataaccctagggatatagacatctct
aaagctattatagatgaggtaaatagatatggtattgacattgtagttgaggcttcaggt
agtctagaggcatttaaacaagcattaaaaattgttggatattcaggtaggattctagtg
tttggagttccaccgagagaatctgaagtcggtataaggttgtttgatgtatatagaaag
gagatatctattattggaagcttcgtcaatccatatactatgtatagagccctagatata
ttgagagctaatataatatcggtaaacgatataattacccatagagtgagtctaatggaa
attctagatatattgaagggaaacataccaagaaatgcaataaaaattgtatcagtattc
taa

DBGET integrated database retrieval system