KEGG   Ignisphaera aggregans: Igag_0313
Entry
Igag_0313         CDS       T01307                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K17818  D-arabinitol dehydrogenase (NADP+) [EC:1.1.1.287]
Organism
iag  Ignisphaera aggregans
Pathway
iag00040  Pentose and glucuronate interconversions
iag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Igag_0313
Enzymes [BR:iag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.287  D-arabinitol dehydrogenase (NADP+)
     Igag_0313
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox 2-Hacid_dh_C TrkA_N Sacchrp_dh_NADP NADH_4Fe-4S UDPG_MGDP_dh_N Pyr_redox_2 ThiF ADH_zinc_N_2
Other DBs
NCBI-ProteinID: ADM27159
UniProt: E0SQT5
LinkDB
Position
complement(273427..274449)
AA seq 340 aa
MSIMKALVIIEPRKAEVRDVDIPEPRDNEVLVRVRACGLCQTDRHIYEGEFLAKYPIIPG
HEFSGEVIDTGKNVDMVRKGDRVVIDPNISCGRCYYCRSGMKHLCENWQGIGVTLNGGFA
EYALVPQENVYIMPRDLSFEAASLTEPLACIIHGIDRIGMAIGKTIAIFGAGPIGLMFLQ
LLRHFGASKIVVFDINDYRLEVAKKLSADYVYNPRDIDISKAIIDEVNRYGIDIVVEASG
SLEAFKQALKIVGYSGRILVFGVPPRESEVGIRLFDVYRKEISIIGSFVNPYTMYRALDI
LRANIISVNDIITHRVSLMEILDILKGNIPRNAIKIVSVF
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtattatgaaggcattagtaataatagagcctcgtaaggcagaggtgagagatgta
gatatacctgagcctagagataatgaggttttagttagggttagagcctgtggactatgt
caaactgatagacatatatatgaaggtgaatttctagctaaataccctataatacctggc
catgagttttctggagaggttatagatacaggtaaaaatgttgatatggttagaaaagga
gatagagttgttatagatccaaatatatcgtgtggaagatgctactactgtagatctgga
atgaagcacctctgtgaaaattggcagggaattggtgttacactcaatggtggatttgca
gaatatgctctagttccacaggaaaatgtctatataatgccgagagatctatcatttgaa
gctgcatcgcttacagagccacttgcatgtataattcatggaattgatagaattggtatg
gctataggaaaaactatagctatctttggtgcaggccctataggtcttatgtttctacag
ctccttagacattttggagcttcaaaaatagttgtatttgatatcaatgactatagactt
gaggttgctaagaaacttagtgctgattatgtctataaccctagggatatagacatctct
aaagctattatagatgaggtaaatagatatggtattgacattgtagttgaggcttcaggt
agtctagaggcatttaaacaagcattaaaaattgttggatattcaggtaggattctagtg
tttggagttccaccgagagaatctgaagtcggtataaggttgtttgatgtatatagaaag
gagatatctattattggaagcttcgtcaatccatatactatgtatagagccctagatata
ttgagagctaatataatatcggtaaacgatataattacccatagagtgagtctaatggaa
attctagatatattgaagggaaacataccaagaaatgcaataaaaattgtatcagtattc
taa

DBGET integrated database retrieval system