KEGG   Ignisphaera aggregans: Igag_0943Help
Entry
Igag_0943         CDS       T01307                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
iag  Ignisphaera aggregans
Pathway
iag00040  Pentose and glucuronate interconversions
iag00051  Fructose and mannose metabolism
iag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:iag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Igag_0943
   00051 Fructose and mannose metabolism
    Igag_0943
Enzymes [BR:iag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Igag_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF4862
Motif
Other DBs
NCBI-ProteinID: ADM27758
UniProt: E0STZ2
LinkDB All DBs
Position
complement(888918..889910)
Genome map
AA seq 330 aa AA seqDB search
MELKFSTGIWVLGPGYERFAPQGYRSAKDVVELIAQASRVRDLKGLEFHYPTEVNESNVK
SVKKALEDYNLVAAAIPPVLSQEPIWARGALSALDNDVRRKAIERCKRATDIARELGAKV
LIIWPGREGFDFPFTTNYKKLWDNYVDALAEVAEYASDLKVAIEYKMEDPSSYLIHGSAG
KVAATILELRQRGINNVGVNIEFAHAKLAKEYVPEAVVFLSRINALQHLHLNDIFTEVDL
DLFPASVHLLEYFELLYWLHEINYDGWMGLDLFPRYLDPVEMLQQSIDNIKAIYSTLERV
GWSKIRSVIEMNSPIETQKLLRELLTGYTK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagctaaaattttcaacaggtatatgggttttaggcccaggatatgagagatttgct
ccacagggatatagatctgctaaagatgttgttgaacttatagcacaggcttctagggtt
agagatctaaagggtttagagtttcactatccaacagaggtaaatgagtctaatgttaaa
agtgttaagaaggctttagaggattataaccttgttgcagcagctatacccccagttctt
tctcaggagcccatatgggctagaggagcactttctgcacttgacaatgatgttaggagg
aaggctattgagaggtgtaagagggctacagatatagctagagagcttggagctaaagtc
ctcattatatggcctggtagagaggggtttgactttccatttacaacgaattacaaaaag
ctatgggataactatgtagatgcattagcagaggtagcagagtatgcatctgatctaaag
gtagctatagagtataagatggaggatccaagtagctatctaatacatgggtctgcaggt
aaggttgcagctacaattctagagcttagacagaggggtatcaataatgttggtgtaaat
atagagtttgcacatgccaaactagctaaggagtatgtaccagaggctgtagtatttcta
tcaaggataaacgctctccagcatctccatctaaacgatatatttacagaggtagaccta
gatctattcccagcaagtgtacatctactagaatactttgaacttctatactggctacac
gagataaactatgatggttggatgggactagatctattcccgagatatctagaccctgta
gaaatgcttcagcaaagcatagacaatataaaagctatatacagcactcttgaaagagtt
ggatggagcaagataagatcagtaatagagatgaactcacctatagagacacagaaactc
ttgagagagctactcacaggctataccaaataa

DBGET integrated database retrieval system