KEGG   Ignavibacterium album: IALB_2979Help
Entry
IALB_2979         CDS       T01943                                 

Gene name
aceF
Definition
(GenBank) Pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ial  Ignavibacterium album
Pathway
ial00010  Glycolysis / Gluconeogenesis
ial00020  Citrate cycle (TCA cycle)
ial00620  Pyruvate metabolism
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01120  Microbial metabolism in diverse environments
ial01130  Biosynthesis of antibiotics
ial01200  Carbon metabolism
Module
ial_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ial00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_2979 (aceF)
   00020 Citrate cycle (TCA cycle)
    IALB_2979 (aceF)
   00620 Pyruvate metabolism
    IALB_2979 (aceF)
Enzymes [BR:ial01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     IALB_2979 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 DbpA PUMA RnfC_N DUF2254
Motif
Other DBs
NCBI-ProteinID: AFH50682
UniProt: I0ANX5
LinkDB All DBs
Position
3387641..3389320
Genome map
AA seq 559 aa AA seqDB search
MQKEFKLPELGENIEAADIVNVLVKEGDFIKKDQGVVEIETDKATIEVPSTIEGKISKLL
VKPGDKIKVGSTIMIVEEDAAESLKQTEATSEHKTEEKPTEVKTEKPSEPKASTSTAPKV
SGKKEIVEFHLPELGENIETADVVNVLVNVGDVIEKDQGIIEIETDKATIEVPSTVSGRV
AEVFVKAGEKAKVGQTIIKIETGELSETIPSESTTAQARNEQVSEEKKTEVTKTSTTVVK
GELPALHPMEFDEQPPILKGSAPAAPSVRRLAREIGVDINKVPGTGPGGRITMDDVKAYS
KKLHESRAEGGFTPGIKAEALPDFSKFGEIRKVEMSNIRKKTAEHLSYAWATIPHVTQFD
KADITNLEKTRKELSKIVEKSGAKLTVTGILVKVIVEALKKFPQFNSSIDMEKKEIIFKN
YFNIGIAVDTEHGLIVPVIKDADKKSLTQISVEMNSLAEKARTKKIGLEDLQGGCFTITN
LGGIGGTYFTPIVNSPEVAILGVSRSAYEPVWNGYGVFEPRLMLPLSLSYDHRIIDGADA
IRFLRFVCESLEEPFRMML
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagaatttaaactaccagaacttggcgagaacattgaggcagccgatattgtc
aatgttctggttaaagaaggtgattttataaaaaaggatcagggtgttgttgaaattgaa
accgacaaagcaacaattgaagtaccttcaacaattgaaggtaagatttcaaaattgtta
gtgaaaccaggtgataaaattaaagtcggttcaacaataatgattgttgaagaagacgca
gcagaatctttaaagcaaacagaagctacttctgaacataagacagaagaaaaaccgact
gaagttaaaacagaaaaaccatccgaaccaaaagcatcgacatcgacagcaccaaaagta
tccgggaaaaaagaaattgttgaatttcatttacctgaattaggagaaaacatcgaaaca
gctgatgttgtaaatgtattagtaaatgtaggagatgtaatagaaaaagatcagggcatt
atcgaaatagaaactgataaagcaaccattgaggttccttcaactgtaagcggaagagta
gctgaagtctttgttaaagcaggagaaaaagcaaaagttgggcagacgataattaagatt
gaaacaggtgaattgtcagagacaataccttctgaatctacaacagctcaagcgaggaat
gagcaggtatcagaagagaagaaaacagaagtcacaaaaacatcaacaactgtagttaaa
ggagaacttccggcacttcatccgatggagttcgatgaacaaccaccaattcttaaaggc
tctgcacccgctgctccctccgtaagaagattggctcgtgaaattggggtggatataaat
aaagttccgggaacaggtccgggcggcagaataacaatggacgatgtgaaagcttactca
aagaagttacacgaatcgagagctgaaggcggatttactccgggaataaaagccgaagct
ttacctgatttttcaaagttcggtgaaatcagaaaagttgagatgagcaatatcaggaag
aaaacagccgaacatcttagttatgcctgggctacaattccacatgttacacagttcgat
aaagctgatataacaaatcttgaaaagacaagaaaagaattaagcaagattgttgagaag
tccggagcaaaactaaccgttacaggaattcttgttaaagtaattgtcgaagcattaaag
aagtttccgcagttcaacagcagtattgatatggagaaaaaagaaattatttttaaaaat
tactttaacatcggaattgctgttgatacagaacatggattgattgttcctgttataaag
gatgccgataaaaaatccttaactcagatttctgttgaaatgaattcgcttgctgaaaaa
gcccgcacaaagaaaattggcttagaggatttacagggaggttgttttacaataaccaat
cttggtggaattggcggcacttatttcacaccaatcgttaactcaccggaagttgcaata
cttggtgtatcaagaagtgcttatgagccagtttggaatggttacggtgtattcgaacca
agattaatgcttcctttatcattgtcttatgatcatagaattattgatggtgctgatgca
ataaggtttttaagatttgtttgtgaatcactggaagagccatttaggatgatgctttag

DBGET integrated database retrieval system