KEGG   Intestinimonas butyriciproducens: IB211_00591Help
Entry
IB211_00591       CDS       T04182                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydratase
  KO
K01715  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00650  Butanoate metabolism
ibu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IB211_00591
Enzymes [BR:ibu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     IB211_00591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ALP92986
UniProt: A0A0S2W0Y8
LinkDB All DBs
Position
570295..571071
Genome map
AA seq 258 aa AA seqDB search
MSYKNIKIEITGGIAVLTLNRPEVRNALDFETWEEIRSGMQELGRREGVQVIIFTGAGGK
AFASGTDIRAIHDRTVAEQMNSEVSDTLYEISTHKRPVIAAIDGYALGGGCELAMACDIR
IATKKSRFGQPEVGLGIIPGAGGTQRLQRLVGIGKAKELIFTGDIISAEEAERIGLVEKV
VEDGTVMDAAMEMAKKIRAKGPVAITLAKKAIQVGADTDLYSGLCFERYAQALAYSTDDK
AEGTQAFLEKRPPAFKGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaaaaacatcaaaatcgagatcacaggcggcattgcggtcctgacgctgaac
cggcctgaggtccgcaacgccctggattttgagacctgggaagagatccggagcggaatg
caggaactgggccgaagggaaggcgtgcaggtgatcatctttaccggagccggcggcaag
gcatttgcctcggggaccgatatccgcgccatccatgacaggacagtggccgagcagatg
aacagcgaggtcagcgacacgctctatgagatatccacccacaaaaggcccgtcatcgcc
gccatagacggctatgcgctgggcggcggctgtgagctggccatggcctgcgacatccgc
attgcaaccaagaagtccaggttcgggcagccagaggtggggctgggcatcattcctggc
gctggcgggacgcagcggctccagcgtctggtgggcatcggcaaggccaaagagctcatt
tttaccggggatatcatctctgccgaggaggcggagcggatcggactggtggaaaaggtg
gtggaggacggcacggtgatggacgcagccatggagatggcgaaaaagatccgggccaag
gggccggtggccatcactctggccaaaaaggccatccaggtgggcgccgacaccgatctt
tactccgggctgtgctttgagcggtatgcacaggccctggcctattccaccgacgacaag
gcggaggggacgcaggcgttcctggagaagcggcctcctgcgttcaaaggcaagtaa

DBGET integrated database retrieval system