KEGG   Intestinimonas butyriciproducens: IB211_01971cHelp
Entry
IB211_01971c      CDS       T04182                                 

Definition
(GenBank) RNA polymerase sigma factor RpoD
  KO
K03086  RNA polymerase primary sigma factor
Organism
ibu  Intestinimonas butyriciproducens
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ibu03021]
    IB211_01971c
Transcription machinery [BR:ibu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     IB211_01971c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r3 Sigma70_r2 Sigma70_r4 Sigma70_r1_2 Sigma70_r1_1 Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: ALP94362
UniProt: A0A0S2W4P1
LinkDB All DBs
Position
complement(1948911..1950230)
Genome map
AA seq 439 aa AA seqDB search
MSEKRVLDMPAETDKKPKMTSEEKIEAGKIELMKVVEGVQGAEKLAELLDKGKKKGKLSS
GELMDVLEEMDLESEQLDKIYDTMENMGIDTAGEDYLPELVDEVPPIEEIEEIPEEEIVD
PNTLVDSFGIDDPVRMYLKEIGKVNLLTPDEEIQLAQDMGAGDAAREQLAEIEKARKNGE
EVSLAQEEEKELKRAIRKGEAAKQRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNLGLI
KAVEKFDYTKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKVIRVSRQLLQE
LGHDPTPEEISEEMNMPVDKVREILKIAQEPVSLETPIGEEEDSHLGDFIPDEDASEPSE
AASYTLLKEQLIDVLDTLTPREEKVLKLRFGLEDGRTRTLEEVGKEFNVTRERIRQIEAK
ALRKLRHPSRSKKLKDFLN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaagagtgctggatatgccggctgagaccgataagaagccgaagatgacc
agtgaggaaaagatcgaagccggcaagatcgagctgatgaaggtcgtcgagggggttcag
ggcgcggaaaagctggcggaactgctggacaagggcaaaaagaagggcaaactctcctcc
ggcgagctcatggacgtcttggaggaaatggatctggagagcgagcagctcgataagatt
tacgacaccatggaaaatatgggcatcgacaccgcgggagaggactatcttcccgaattg
gtggatgaggtccccccgatcgaggagatcgaggagatccccgaggaggagatcgtggac
cccaacaccctggtggactccttcggcatcgacgaccctgtacggatgtacctcaaggag
atcggcaaggtaaatctgctcacccccgacgaggagatccagttggctcaggacatgggc
gcgggggacgcagccagggaacagctggccgaaatcgaaaaggcgcggaagaatggagaa
gaggtctccctcgcgcaggaggaggagaaggagctcaagcgcgccatccgtaagggcgag
gccgccaaacagcgcctggcggaggccaatctccggctggtggtgtctattgccaaacgg
tacgtgggcaggggaatgctcttcctggacctcattcaggagggcaacctgggcctcatc
aaagcggtagagaagtttgactacaccaagggctacaagttctccacatacgccacctgg
tggatccgccaggccattacccgcgccatcgcagaccaggccaggaccatccgtatcccg
gtccatatggtggagaccatcaacaaggtcatccgggtctcccgccagctcctccaggag
ctgggccacgaccctaccccggaggaaatctccgaggagatgaacatgccggtggacaag
gtacgggagatcctgaaaatcgcccaggagccggtctctctggagacccccatcggtgag
gaggaggactcccacttgggcgactttatcccggatgaggacgcttctgaaccctccgag
gcggccagctacacccttctgaaggagcagctcatcgacgtgctggatacgctgacgccc
cgggaggaaaaggtgctcaagctccgctttggtctggaggatggacgcacccgcacgctg
gaagaggtgggcaaggagttcaatgtgacccgtgagcgtatccgccagattgaggcgaag
gcccttcggaagctgcgccatccctcccgctccaagaagctgaaggactttttgaactga

DBGET integrated database retrieval system