KEGG   Intrasporangium calvum: Intca_0030Help
Entry
Intca_0030        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10
Motif
Other DBs
NCBI-ProteinID: ADU46592
UniProt: E6SEJ1
LinkDB All DBs
Position
complement(31014..33530)
Genome map
AA seq 838 aa AA seqDB search
MSGKSGLAIRRISGHCTITGDKLMAWYLLDPQGWSFRPDGVREQLIVDGADVFGQLVRRE
IHLRVTTRPYPVARWAADHDANAPAPLPAWRDHLITDQRRLASLSMADKEVYLGVEIPTR
SPVYKALGSFWGSMSDREVAALSGHVRATDELMASPGIEAAPATPRQLEWLLHRSCSLGL
PAPVTLGASDLEAWETEDLHEFTDHVRWFALPYGRTIRVVGEHDDERIERHVCVLSVGRM
TDLEIPPGIPWMQRTDQLPFPVEWSGRVRIEDAAKVGAALRQNIQKIRAQRDHYEVEHQE
PAPGALDRQAARALTVEDEISMGLSGLSTRTSGWYRIAVSAPTEDEAIQRAGVIRKLFAP
QITIARPHDQYAVAREFIPGERLSTTAFRRRMPVTTLAAAVPAATAKVGDRIGIHLGETS
GTSSRVVTWEPWLATERGEESGLAVLCAGLGGGKSTAGGNIIYRTVIQGVPWTVLDPSGR
LTALCRLPELEQYSRAIDLLDAAPGSLGTYRVIAEPRRDHYAEESEFRAAKEQAQDTRRL
LTNSVLRAMLPRQLQEHVLTEVALLRAVGRVPANAWSACDQVVTELATLEGDEALVRHAG
YMADFLREAAKTSHGRLVFPAGKALDTSSEEPLLTVYSLRGLALPDESTAGSEDLDERLS
MCVMYLAAWLTQRGMYFGDINARKGIFIDEAWALSTFSTGRRFIDRAARDSRKHNTRVLM
ASQNPSDLLKLDLANLSSAAFIGRLTGEEAQRDALRFIPGIRDGLGYEQIFGTLSRPSRD
GLRGPREFVFSDGNGGIERIRMDLSAHPHLLDALNTTAEPLKARNRAARELDDEKASA
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaagagcggcctcgcgatccgccgaatcagcggccactgcacgattaccggc
gacaagctcatggcctggtatctccttgacccgcaaggctggtcgttccggcccgacggc
gtccgggagcagctcatcgtcgacggcgctgatgtcttcgggcagctcgtacgccgagag
atccacctccgggtcaccacgcggccctaccccgtcgcgcgctgggcggccgaccacgac
gccaacgcccccgcgcctctgcccgcctggcgtgaccacctcatcaccgaccagcgccgc
ctagcgtcgctcagcatggccgacaaggaggtctacctcggcgtcgagatcccgacgcga
agcccggtctacaaggccctggggtcgttctgggggtcgatgtcggaccgcgaggtcgcc
gcgctctcgggacacgtccgcgccaccgacgagctgatggcctcaccgggcatcgaggcc
gcgcccgcgacaccgcgccagctcgagtggctgctgcatcgctcatgctcgctcggcctc
ccggctcccgtcaccctgggcgcatccgacctcgaggcgtgggagaccgaggaccttcac
gagttcactgaccacgtccgctggttcgcgctcccctacggccggacgatccgggtcgtc
ggcgagcacgatgacgagcggatcgaacgtcacgtctgtgtcctctcggtgggtcgtatg
acggacctcgagatcccgcccgggatcccgtggatgcagcgcacggaccagctccccttc
cctgtcgagtggtccggccgcgtccgcatcgaggatgccgcgaaggtcggagccgccctg
cggcagaacatccagaagatccgcgcccagcgcgaccactacgaggtcgagcaccaggag
ccggctcccggggccctggaccgacaggcagctcgtgccctcaccgtcgaggacgagatc
tccatgggcctctccgggctgtcgacccgcacctcgggttggtatcgcatcgcggtgtcc
gctcccactgaggacgaagcgatccagcgagccggggtcatacgcaagctgttcgcccca
cagatcaccatcgcgcgtccacacgaccagtacgccgtggcacgcgagttcatccccgga
gagcgactcagcaccacggcattccggcgccgtatgccggtcaccacccttgcggccgcc
gtccccgctgctacggccaaggtgggcgaccggatcggcatccacctcggggagacctcc
gggacctcctcacgggtcgtgacctgggagccctggctggcgaccgaaagaggcgaggag
tccgggctggccgtcctgtgcgcaggcctcggcggcggcaagtccacggcaggcggcaac
atcatctaccgcaccgtcatccaaggtgttccttggaccgtgctcgacccctcgggccgg
ctcaccgccctgtgccggcttcccgagctcgagcagtactcccgcgccatcgacctcctc
gacgccgcgcctggctctctcggcacctaccgagtcatcgccgagcctcgtcgcgaccac
tacgccgaggagagcgagttccgcgctgccaaggaacaggcccaggacacccgccgcctc
ctcacgaacagcgttctgcgggccatgcttcccaggcagctgcaagagcacgtcctcacg
gaggttgccctgcttcgcgccgtgggacgggtgcccgccaacgcctggagcgcctgcgac
caggtcgtgaccgagctcgcgacgctcgagggcgacgaggcactggtgcgccatgccggc
tacatggccgacttcctccgagaggccgccaagacgagccacggccgactcgtcttcccg
gctggcaaggccctcgacacctccagcgaggagccgctccttaccgtttactcgctacgg
ggcctcgcccttcccgacgagtccacggctggctcggaagacctcgacgagcgactctcc
atgtgcgtcatgtacctcgccgcttggctgacccagcgcggcatgtacttcggggacatc
aacgcacgcaagggcatcttcatcgacgaggcgtgggcgctctcgaccttcagcaccggc
cggcgattcatcgaccgggccgcccgggactcgcgcaagcacaacacccgcgtgctcatg
gcgagccagaacccctccgacctgctcaagctcgacctggccaacctcagctccgcggcc
ttcatcggccggctcaccggcgaggaggcccagcgcgacgccctgcgcttcatcccaggc
atccgcgacgggctcggctacgaacagatcttcggcaccctctccagaccgagtcgtgac
gggctgaggggcccgcgtgagttcgtcttcagcgacggcaacggagggatcgagcggatc
cgcatggacctctcagcacacccgcacctcctcgacgcactcaacacgaccgccgaaccg
ctcaaggcccgcaaccgcgccgcccgtgagctcgacgacgagaaggcgagtgcgtga

DBGET integrated database retrieval system