KEGG   Intrasporangium calvum: Intca_0081Help
Entry
Intca_0081        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT_2
Motif
Other DBs
NCBI-ProteinID: ADU46643
UniProt: E6SEP2
LinkDB All DBs
Position
90606..91670
Genome map
AA seq 354 aa AA seqDB search
MAQPGREVPWFSGFGPPGRLSPGNRAMAYAAGPEVSAAIPEQSDRPPRIVDEVGVGSSRT
KRAAGGAGGVAVLLCSVLTAPALAADTSPVPRPSPGAPVASQGVADPVAPVPPVAPIDPL
GSGAGESLLRLYDVVKVTAGYVAATRLEPGGGSSRPGRDSAWQPPADLQTPPVTPGTAAG
PGRRMTKYDVLGAAYQKAADALADSCQLPFAVLMAIGEVESGSLRGRTLDVRHNVVPPII
GPALSGSGFAAIRDSDRGRLDGDPVWDRAVGPMQFIPGTWRLWGADGNGDGVADPQNVED
AALSAGRYLCAGGRDLARQADLERAILSYNHSRRYLETVLDLYDSVMGGAVAGP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccggccgcgaggtcccgtggtttagcgggttcgggccccccggccggctc
tccccgggtaaccgggcgatggcgtatgccgctgggcccgaggtgagtgcggccatcccc
gagcagtcggaccgaccgccccgtatcgtcgatgaggtgggggtcgggtcgtcacggacg
aagcgagcagccgggggagccgggggcgtcgcagtgctgctgtgttctgtgctgaccgcg
ccggcgctggcagccgacaccagcccggtgccgcgcccctcgcccggtgccccggtggca
tcgcagggcgtggcggatcctgtcgcccccgtccctcccgtcgccccgatcgacccgctc
gggtccggcgccggcgagtcgctgctccgcctctacgacgtcgtcaaggtgaccgcgggc
tatgtcgcggcgacccgtctcgagccgggaggcggatcctctcgcccggggcgcgactcg
gcctggcaacccccggccgacctgcagaccccgcccgtcacaccgggaacggccgccggg
cccgggcgaaggatgacgaagtacgacgtcctcggggccgcttaccagaaggcggccgac
gcgctggctgacagctgccagcttcccttcgccgtgctgatggccatcggcgaggtggag
tccggctccctccggggccgcaccctggacgtccgccacaacgtcgtgccaccgatcatc
ggtccggcactcagcggaagcggcttcgctgcgatccgcgacagtgacaggggccggctg
gacggagaccccgtctgggaccgggccgtgggcccgatgcagttcatccccggaacgtgg
cggctgtggggcgcagacggcaacggggacggggtcgcggacccccagaacgtcgaggac
gccgcgctctccgcgggccgctacctctgcgcgggtggacgggacctggctcgccaagcc
gatctggagagggcgatcctgtcctacaaccactcccgccgctacctcgagacggtgctc
gacctctacgactccgtcatggggggcgccgtcgccggaccgtga

DBGET integrated database retrieval system