KEGG   Intrasporangium calvum: Intca_0143Help
Entry
Intca_0143        CDS       T01385                                 

Definition
(GenBank) transcriptional regulator, LuxR family
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 GerE TPR_12 Sigma70_r4 AAA_22 HTH_24 ArnB_C Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: ADU46704
UniProt: E6SFG6
LinkDB All DBs
Position
complement(154352..157309)
Genome map
AA seq 985 aa AA seqDB search
MPFTTGALVGRGSELARLAGAVGLVDSLDGTRGGVAIVSGDAGIGKSRLLLQLTTDADRA
GWLTATGHCVGQAGSALAYLPFVELIGLLDRMTPDVVTQVLGSHPSLARLLPRRDGVTGT
GGGADSAKEASPGLVAESVHALLTAFGAVRPTLVVIEDVHWADHSSRDLLTLLLTRSFTT
PVALVASYRSDDLHRKHPLHETLAVWDRIPHVTHVSLAPLPDAAVDEIVEGIEGVPDDPR
TMREITRRAEGNPFFAEELAASAVAGQQVSGGLGRVLRARVERLDETSQAVVRAVSLKGG
RFIGHELLSRIMGLPEPVLEAAIAQAVEHHVLETSWPPAYTFRHALLGETAAESLLPGER
LRLHKAYAAVLAECPHLAPASELARHAAASGDLPAAVAASRAAAESAMEVGGPQDALFHL
EQALSWLEDDAAERDEVTIRASEAATAAGDILRAVRLLKDGIDHPGPRQRDEVRAELLAR
YATLSRMLDLPVEGLALTSRAVDLLPDEETPRQVLVLIAHVQQLVDAGELDDAVRTGDEV
MATAERLGLRESLLEIRTILTRVIEAQQDLDAVEAHLRGLFADVRGTDNPIQLRLTHQLA
AVAHRRGDLRGALAHYDEGTRIARRLHQEWAPWGLDCRLLSGLTAYELGDWDDVPSRLAL
ASKVTPQPARALFEAAALGVAVGRGEPVPPSRLSSLREWWYVDGLAVVLTVMPGIDLLGD
AGDLTGMLEIACEAAQTLDTAWGKYHASVRLAALVAGQVATLAPRAAPELRERAARTVDD
LGRRADQLVAKVIRTSQGTGWDPTDVDVLGESSTETWAWARRLRAERLRLAWVLGQEDPP
PVEEMLVAWRASVEAFDRLGHVFEAARSRGRLAAALHAAGRDVDSRQVAGSAREVAVRLR
ARPLLAELDALAPRAPAAATAVELTPRELEVLALVARGLSNGQIGKQLYISTKTVSVHVS
NLLAKLGASGRTEAAAIARDRALVP
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcaccaccggggccctggtcggccggggctcggagctggcccgcctcgcgggt
gccgtcgggctcgtcgactcgctcgacggcacccgcggcggcgtggccatcgtctccggg
gatgccggcatcggcaagtcgcggctgctcctgcagctgaccacggacgcggaccgggcc
gggtggctcaccgcgacgggccactgtgtcgggcaggccggtagtgccctcgcctacctc
ccgttcgtggagctcatcggcctgctcgaccgcatgacccctgacgtcgtcacccaggtc
ctcggctcacacccgagcctggcccggctcctcccacgcagggacggcgtcacgggaaca
gggggaggcgccgactcggcgaaggaggccagccccggcctcgtcgccgagtcggtccat
gccctcctcacggccttcggggccgtccggccgactctcgtcgtcatcgaggacgtgcac
tgggcggaccactcgtcgcgcgacctgctcaccctcctgctcacccgctccttcacgact
ccggtcgccctggtcgccagctaccgctccgacgacctccaccgcaagcacccgctgcac
gagacgctggccgtgtgggaccgcatcccgcacgtgacgcatgtcagcctcgcgccgctc
cccgacgccgccgtggacgagatcgtcgaggggatcgagggggtcccggacgacccgcgc
accatgcgagagatcacccggcgggcagagggcaacccgttcttcgccgaggagctcgcg
gcgagcgccgtggcgggccagcaggtgagcggcgggctgggccgggtcctgcgcgcccgc
gtcgagcgcctcgacgagacgtcccaagcagtcgtgcgagcggtctccctcaagggtggc
cggttcatcggccacgagctgctgtcccggatcatgggcctgcccgagccggtgctcgag
gcggcgatcgcccaggcggtcgagcaccacgtcctcgagacgagctggcctcccgcctac
accttccgccatgcgctcctcggtgagaccgcggccgagtccctcctcccgggggagcgt
ctccggctccacaaggcgtatgccgctgtgctcgccgagtgcccacacctggctccggcg
tcggagctggctcgccacgccgccgcgagcggggacctccctgccgcggtggccgcgagc
cgcgctgccgccgagtcggcgatggaggtcggcgggccgcaggatgcgctgttccacctc
gagcaggcgctgagctggctggaggacgatgctgccgagcgcgacgaggtgacgatccgg
gcgtcggaggcggccactgcggcgggtgacatcctgcgcgcggtccggttgctcaaggac
ggcatcgaccatcccgggccgcggcagcgggacgaggtccgcgccgagctcctggcgcgc
tacgccacgctctcgcggatgctcgacctgccggtggagggcctcgccctgacctcccgg
gccgtggacctgctcccggacgaggagacgccgcgacaggtgctcgtgctcatcgcgcac
gtccagcagctcgtcgatgcgggcgagctggacgatgcggtccgcacgggagacgaggtg
atggcgacggccgagcgcctcggactgcgcgagtcgctcctcgagatccgcacgatcctc
acccgggtcatcgaggctcagcaggacctggacgccgtcgaggcccatctgcgggggctg
ttcgctgacgtgcggggcacggacaacccgatccagctgcggctgactcaccagctcgcc
gcggtggcccaccgccgtggcgacctccgtggcgccctcgcccactacgacgagggcacc
cgcatcgcccgccgcctgcaccaggagtgggctccctggggcctcgactgtcgcctgctc
agcgggctcaccgcctacgagctgggtgactgggacgacgtcccgagccggctggccctc
gcctcgaaggtgaccccgcaaccagctcgggccctcttcgaggccgcggcgctcggcgtg
gcggtgggtcgaggggagccggtcccaccgagccgcctgtcgtccctgcgcgagtggtgg
tacgtcgacgggctcgcggtggtgctcacggtcatgcccggaatcgacctgctcggcgat
gccggcgatctgaccggcatgctggagatcgcctgtgaggcggcgcagaccctcgacacg
gcgtggggcaagtaccacgcgagcgtgcggctggccgccctggtcgccgggcaggtggcg
acactcgctccgcgcgccgctcccgagctccgggagcgggccgcacgcacggtcgacgac
ctggggaggcgggccgaccagctcgtggccaaggtgatccgcacctcccagggcacgggc
tgggacccgaccgacgtcgatgtgctcggcgagtccagcaccgagacctgggcgtgggcc
aggcggctccgcgccgaacggctgcgcctcgcttgggtgctggggcaggaggaccccccg
cctgtggaggagatgctcgtcgcgtggcgggcgtcggtggaggccttcgaccgcctgggg
cacgtcttcgaggcagcccggtcccgcgggcggctcgccgcggcgctccacgccgcgggt
cgtgacgtcgattcgcggcaggtcgccgggtcggcccgcgaggtcgcggtgcggcttcgg
gcacgaccgctcctggccgagctcgacgccctggccccccgcgcaccggccgctgccacg
gccgtcgagctgaccccgcgcgagctcgaggtcctcgccctggtcgcacgagggctgtcc
aacggccagatcggcaagcagctctacatcagcaccaagacggtgagcgtccacgtctcc
aacctgctcgccaagctcggggcctcgggccgcaccgaggcggccgccattgcgcgcgac
cgggccctcgtgccctga

DBGET integrated database retrieval system