KEGG   Intrasporangium calvum: Intca_0516Help
Entry
Intca_0516        CDS       T01385                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ica  Intrasporangium calvum
Pathway
ica00010  Glycolysis / Gluconeogenesis
ica00620  Pyruvate metabolism
ica00630  Glyoxylate and dicarboxylate metabolism
ica00640  Propanoate metabolism
ica00680  Methane metabolism
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01120  Microbial metabolism in diverse environments
ica01130  Biosynthesis of antibiotics
ica01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ica00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Intca_0516
   00620 Pyruvate metabolism
    Intca_0516
   00630 Glyoxylate and dicarboxylate metabolism
    Intca_0516
   00640 Propanoate metabolism
    Intca_0516
  09102 Energy metabolism
   00680 Methane metabolism
    Intca_0516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ica01004]
    Intca_0516
Enzymes [BR:ica01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Intca_0516
Lipid biosynthesis proteins [BR:ica01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Intca_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADU47061
UniProt: E6S985
LinkDB All DBs
Position
complement(555813..557789)
Genome map
AA seq 658 aa AA seqDB search
MSETLENLLQETRTFPPPPEFASRANGTAELYEKADADHEGFWAEQARTYVSWSKDFTQT
LQWDTPFAKWFPDGELNACYNAVDRHVEAGNGDRVAIHWIGEPEGDTREITYSDLHSSVQ
RAANALQDIGVRKGDTVAIYLPMIPEAAVAMLACARIGAPHSVVFGGFSAEALHSRIDDA
GAKVVITSDGGYRRGSASPLKPAVDAALDHGDTSVEKVLVVKRTGQETPWTEGRDLWWDE
VLEQAAPTHEAPAHESEHPLFILYTSGTTGKPKGIFHTTGGYLTQCAYTNAVVHDVHPES
DVYWCTADIGWVTGHSYIVYGPLTLGATQVMYEGTPDTPHQGRFWEIVEQKKVTILYTAP
TAIRTFMKWGDDIPGKFDLSSLRLLGSVGEPINPEAWMWYRRVIGGDRCPIVDTWWQTET
GAIMVSPLPGVTATKPGSAQRAIPGIGAEVVDDMAQPVPNGHGGYLVLTKPWPAMLRGIW
GDPERYKETYWSRFEGLYFAGDGAKKDDDGDIWLLGRVDDVMNVSGHRLSTTEIESALVS
HPKVAEAAVVGATDETTGQAVVAFVILRSEAVAEADEPGEGADIVAELRNHVAKEIGPIA
KPRSIMIVPELPKTRSGKIMRRLLRDVAENRQVGDVTTLADSSVMELIKTGLNKGDGD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacgctcgagaacctcctccaggagactcggaccttcccaccccctcctgag
ttcgcttcccgggccaacggcacggctgagctgtacgagaaggcggacgccgaccacgag
ggcttctgggccgagcaggcccgcacgtacgtgtcgtggagcaaggacttcacgcagacc
ctccagtgggacaccccgttcgccaagtggttccccgacggcgagctcaacgcctgctac
aacgcggtcgaccggcacgtcgaggccggcaacggcgaccgggtcgcgatccactggatc
ggcgagcccgagggtgacacccgcgagatcacctactccgacctgcactcctcggtccag
cgggccgcgaacgcgctgcaggacatcggggtccgcaagggtgacacggtcgcgatctac
ctgccgatgatcccggaggcggccgtcgcgatgctcgcctgcgcccgcatcggcgcgccc
cactccgtcgtcttcggtgggttctcggccgaggccctgcactcgcgcatcgacgacgcc
ggcgccaaggtcgtcatcacgtccgacggtggctaccgccgcggtagcgcctccccgctc
aagccggccgtcgacgccgccctcgaccacggtgacacgtcggtcgagaaggtgctcgtc
gtcaagcgcaccggccaggagaccccgtggaccgagggccgcgacctctggtgggacgag
gtgctcgagcaggccgccccgacccacgaggcgccggcgcacgagtccgagcacccgctg
ttcatcctctacacgtcggggaccaccgggaagcccaagggcatcttccacacgaccggc
gggtacctcacgcagtgcgcgtacacgaacgccgtggtccacgacgtccacccggagagc
gacgtctactggtgcaccgccgacatcggctgggtgaccggccactcctacatcgtctac
gggccgctgacgctcggcgcgactcaggtgatgtacgagggcaccccggacaccccgcac
cagggtcgcttctgggagatcgtcgagcagaagaaggtgacgatcctctacaccgctccg
acggcgatccgcaccttcatgaagtggggcgacgacatcccgggcaagttcgacctgagc
tcgctgcggctgctcggctcggtcggtgagccgatcaaccccgaggcctggatgtggtac
cgccgcgtcatcggtggggaccgctgcccgatcgtcgacacgtggtggcagacggagacc
ggggcgatcatggtcagtcccctccccggtgtcacggcgaccaagccggggtcggcccag
cgggcgatcccgggtatcggcgccgaggtcgtcgacgacatggcacagccggtccccaac
ggccatggcggctacctcgtgctgaccaagccgtggccggcgatgctgcgcggcatctgg
ggcgacccggagcgctacaaggagacgtactggagccggttcgagggcctctacttcgcc
ggcgacggcgcgaagaaggacgatgacggcgacatctggctgctcggccgcgtcgacgac
gtcatgaacgtctcgggtcaccgcctgtcgacgacggagatcgagtccgccctcgtgtcg
cacccgaaggtcgccgaggccgctgtcgtcggcgcgacggacgagacgacgggccaggcg
gtcgtggcgttcgtcatcctccggtccgaagcggtcgccgaggccgacgagccgggtgag
ggcgccgacatcgtcgccgagctgcgcaaccacgtcgcgaaggagatcggccccatcgcg
aagccgcggtcgatcatgatcgttcccgagctgccgaagacgcgctccggcaagatcatg
cgccgcctgctccgcgacgtcgccgagaaccgccaggtcggcgacgtgacgacgctcgcg
gacagctcggtcatggagctgatcaagaccggactcaacaagggcgacggggactga

DBGET integrated database retrieval system