KEGG   Intrasporangium calvum: Intca_0564Help
Entry
Intca_0564        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RskA
Motif
Other DBs
NCBI-ProteinID: ADU47109
UniProt: E6S9D3
LinkDB All DBs
Position
complement(618647..619426)
Genome map
AA seq 259 aa AA seqDB search
MSHPDDELLADVALDVDKPPPGTHEHLGECLECRRAVDQLRRTTVLLSQGSATIPSPAAW
QSPPPHVWQRVAAAIADRDPVPAPGPAPSPAPAPAPVPAHRAEVTRLDLTASRRRQGWPW
AAGLAAAGLAVGLLTGRALWNETPPPSTTVARAELDTLDMKARLGEAAVVRSDAGVNLQV
ATTTTLDPRDGYLEVWLINSDGKRMVSVGVLDTQSGTFPISQSLLDQGYLVVDISREPFD
EQPEHSGDSLLRGALPAQT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcatcctgatgacgagctgctggccgacgtcgccctcgacgtcgacaagccgccg
cccgggacgcacgagcacctcggggagtgtctggagtgccgacgcgctgtggaccagctg
cgccgaacgacggtgctcctgtcccagggctcggccaccatcccctcccccgccgcctgg
cagtcgcccccaccccacgtctggcagcgcgtcgcggcggccatcgccgaccgcgacccg
gtgccggccccgggtccagccccgagtccagccccggctccggccccggtgccggcccac
cgcgcggaggtgacgcggctcgacctcaccgcgtcccgacgccggcaggggtggccctgg
gcagccgggctggcggcggctggcctcgccgtcggtctcctcaccgggcgcgcgctctgg
aacgagacgcctccgccgagcacgacggtcgcccgggccgagctcgacaccctcgacatg
aaggcgcgtctgggcgaggccgcggtggtgcgttccgatgccggagtgaacctgcaggtg
gccaccacgacgaccctggacccgcgcgacgggtacctcgaggtctggctcatcaacagc
gacggcaagcggatggtgtccgtcggcgtgctcgacacccagtccggcaccttcccgatc
agccagagcctgctcgaccagggctatctcgtcgtcgacatctctcgcgagcccttcgac
gagcagcccgagcactcgggcgacagcctgctccggggcgcgctccccgcccagacctga

DBGET integrated database retrieval system