KEGG   Intrasporangium calvum: Intca_0594Help
Entry
Intca_0594        CDS       T01385                                 

Definition
(GenBank) peptidase S13 D-Ala-D-Ala carboxypeptidase C
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
ica  Intrasporangium calvum
Pathway
ica00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ica00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Intca_0594
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ica01002]
    Intca_0594
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ica01011]
    Intca_0594
Enzymes [BR:ica01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Intca_0594
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Intca_0594
Peptidases and inhibitors [BR:ica01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Intca_0594
Peptidoglycan biosynthesis and degradation proteins [BR:ica01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Intca_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Peptidase_S11 Romo1
Motif
Other DBs
NCBI-ProteinID: ADU47139
UniProt: E6S9U9
LinkDB All DBs
Position
654491..656011
Genome map
AA seq 506 aa AA seqDB search
MRRLTAALTAGAVLAVGYLGLDTADLVPGLLTTRPLPPPPPTETPGIRTLPVVPQPSPST
SVRMPLGSLAGEGAAPSPAGLRKALAGVVTLPALADASLVVRDGQSGGILYDRGGSQRRI
PASTTKLLTAAAVGQVFGGDETLRTEVHEGASADQVVLVAGGDSLLAPGEGDPGAVAGRA
GLADLADQVALALTDSGTERVVLQVDESYAPGPARASTWGEDFHRLGIVGSVAMLGLSTQ
RAGLNRPGPLDPVGATAATFAALLEDRGVRVSQVERLRPGISTGTATGTATGTATGTATG
TATGTATGTPGPGPRVLGSVESAPVRDQLALALTDSDNTLTEILARQAAFRAAPPGSART
DFGTVGAWVVEQVAALGIETTGVALADASGLSRENRVTARLLTDVLALGYDGSHPVLRTA
LEGMPIAGLSGTLAGRYIKDGEPEAAAGRARAKTGTLTGANALAGSVVDDDGRLLVFAGL
VSGAPTEAARAALDDVVSAIAACGCR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcggttgaccgcggcactgacggctggagccgtcctcgcggtgggctacctcggc
ctcgacacggccgatctcgtgccgggcctgctgacgacccggccgctcccgccgccacct
ccgaccgagacgccgggcatccggacgctgccggtcgtgccgcaaccctcgccgtcgaca
tcagtccggatgccgctgggctcgctcgccggggagggcgcggctcccagcccggcgggc
ctccggaaggccctcgcgggcgtcgtgacgctgcccgccctcgccgacgcgtcgctcgtc
gtccgagacggccagtcggggggcatcctctacgaccgtggtggctcccagcgccggatt
cccgcctcgacgaccaagctgctcaccgcggccgcggtcgggcaggtgttcggcggcgac
gagacattgcggaccgaggtgcacgaaggggcgtccgccgaccaggtcgtcctcgtcgcc
ggcggggacagcctgctggcccccggtgaaggagatccgggggccgtggccggccgtgcc
gggctcgccgacctcgccgaccaggttgcgctggcgttgaccgactctggcaccgagcgg
gtcgtgctccaggtcgacgagtcgtacgcccccggcccggcgcgtgcttcgacgtggggg
gaggacttccaccgtctcggcatcgtcgggtccgtcgcgatgctcggactgagcactcag
cgcgccggtctgaaccgccccgggccactggatccggtgggagcgacggcggccaccttc
gcggccctgctcgaggaccgcggggtccgtgtgagccaggtggagcggcttcgccccggc
atctcgacaggcacggcgacaggcacggcgacaggcacggcgacaggcacggcgacaggc
acggcgacaggcacggcgacaggcacaccaggtcccggaccccgcgtgctcggctccgtg
gagtcggcaccggtccgcgaccagctcgctctcgccctgacggactccgacaacaccctg
acggagatcctcgcccggcaggcggctttccgcgccgcacctcccggttcggcgagaacg
gacttcggcacggtgggcgcctgggtcgtcgagcaggtcgccgcactcggcatcgagacc
acgggcgtcgccctcgccgacgccagcgggctgtcccgcgagaaccgggtcacggctcgc
ctcctgaccgacgtgctggccctcgggtacgacggctcgcaccccgtcctgcgcacggct
ctcgagggcatgccgattgccggactgagtggcacgttggccggtcggtacatcaaggac
ggagagccggaggcggcggcgggacgagcccgggccaagaccggcaccctcaccggagcc
aacgcactcgctggttccgtggtcgatgacgacggccgacttctcgtctttgccggactc
gtgtctggtgcgcccaccgaagcagccagggccgcgctcgatgacgtcgtctccgccatc
gccgcgtgcggctgccggtga

DBGET integrated database retrieval system