KEGG   Intrasporangium calvum: Intca_1003Help
Entry
Intca_1003        CDS       T01385                                 

Definition
(GenBank) carbohydrate kinase, YjeF related protein
  KO
K23997  ADP-dependent NAD(P)H-hydrate dehydratase / NAD(P)H-hydrate epimerase [EC:4.2.1.136 5.1.99.6]
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Intca_1003
Enzymes [BR:ica01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     Intca_1003
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.6  NAD(P)H-hydrate epimerase
     Intca_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase YjeF_N
Motif
Other DBs
NCBI-ProteinID: ADU47527
UniProt: E6SCX2
LinkDB All DBs
Position
1111877..1113361
Genome map
AA seq 494 aa AA seqDB search
MIRAASVAEVRAAEAVALAQLPEGELMQRAAEGLAGVAAARLAERDGRTVVALVGAGDNG
GDTLYAAGLLCDAGFACVVVLLPDSGRDGVHAAGLRAAEEAGASVVVASDDPAAAAAAVA
EGDLVLDGIVGIGGRPGLRPPAAALVDAIADDAWVVAVDVSSGLDPDGLDPDGDAVWADE
TVTFGVPKPAHLLPPGEAATGRLTVIDIGLDLAAVPAAVERLIHDDVAALWPVPGPGDDK
YSRGVLGVVAGGELYTGAAVLAVTAAVESGVGMVRYVGTPTPTGLVRHAVPEAVVGEGRV
QAWLIGPGLDPEAPGDEATAQLQVARDALASDLPVVVDAGGLDLLSGPRAAPTLLTPHAG
ELAGLLSRWGSPVSRADVEREPVRHARSAAEQTGATVLLKGSTTIVVGPAPEGPVRSQAD
APAWLATAGAGDVLAGVVGMLLAAGLAPLDAGSLAALVHGVAADRASGGGPLRATAVAGA
LRSTIRDLLRRDPT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgccgcgtcggtcgcagaggtccgcgccgcggaggcggtcgcgctggcgcag
ctgcccgagggcgagctgatgcagcgggcggccgaggggctggccggggtggccgcggca
cgcttggccgaacgggacggtcggacggtcgtcgcgctcgtcggtgccggtgacaacggt
ggagacacgttgtatgccgctgggctcctctgtgacgcaggcttcgcttgcgttgtggtg
ctgttgccagactccggccgggacggtgtccacgctgcgggccttcgcgcggccgaggaa
gcgggtgcctcggtcgtcgtcgcgtcggatgatccggccgcggcggccgcggcggtcgcg
gagggcgatctcgtcctcgacggcatcgtcgggatcggcggccggccggggctccgtcct
ccggctgcggccctcgtggacgcgatcgcggacgacgcctgggtcgtcgccgtggacgtg
tccagcggcctggacccggacggcctggacccggacggcgacgcggtctgggccgacgag
acggtcaccttcggtgtccccaagccggcgcacctcctgccgccgggggaggcggcgacc
gggcggctgaccgtcatcgacatcggtctcgacctcgccgcggtgccggccgccgtcgag
cggctcatccatgacgacgtcgctgccctctggccggtgccgggtcccggcgacgacaag
tactcccggggcgtcctcggcgtcgtggccggcggtgagctgtacaccggcgccgcggtg
ctggccgtcacagccgcggtcgagtccggcgtcggcatggtccgctacgtcggcaccccg
acaccgacgggcctggtccggcacgccgttcccgaggcggtcgtcggtgagggccgggtg
caggcctggctcatcggcccggggctcgaccccgaggcccccggcgacgaggccaccgcg
cagctccaggtggcccgggacgccctggccagtgacctgcctgtcgtcgtggacgcgggt
ggcctcgacctgctctccggcccgcgcgcggctcccaccctgctcaccccgcacgcgggc
gagctggccgggctgctctcccgctgggggtcgccggtcagccgggccgacgtcgagcgc
gagccggtcaggcatgcgcggtcggcggccgagcagaccggggccacggtgctcctcaag
ggctccaccaccatcgtggtcggccccgcgcccgaaggaccggtgcggtcccaggccgat
gctcccgcgtggctggccaccgcgggcgccggtgacgtgctggccggggtggtcgggatg
ctcctcgcagcaggcctcgcgccccttgacgcaggctccttggcggccctcgtccacggc
gtcgccgcggaccgggcctccggtggtgggccattgcgcgccacggccgtggccggggca
ctgcggtcgacgatccgcgacctgctgcgccgcgaccccacctga

DBGET integrated database retrieval system