KEGG   Intrasporangium calvum: Intca_1083Help
Entry
Intca_1083        CDS       T01385                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K03520  aerobic carbon-monoxide dehydrogenase large subunit [EC:1.2.5.3]
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Intca_1083
Enzymes [BR:ica01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     Intca_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Motif
Other DBs
NCBI-ProteinID: ADU47604
UniProt: E6SDZ1
LinkDB All DBs
Position
complement(1195504..1197996)
Genome map
AA seq 830 aa AA seqDB search
MTTQMFGAPVRRREDPRLVTGNGRFLDDLGHDALEAAFVRSPHAHARIVDVDVADAIDVE
GVAGIYVHEDLTGPMAEPLPLLIPHPSLTHGRTAHALARDEVNHVGEAVVMVVARNRYVA
EDACQRIRVTYEQLPVVVGIETARAGEHLVHEDVPGNIAAHLTQEVGDVEAALVAAPHTL
TLDLAIERSASMPLEGKGVYARWDDERGELRMYSSTQTSTGVRAAVAARLGLPLAKVECI
APDVGGGFGVKIMHPWPEEALVAWTARLLGQPVKWTEDRREHFVSSAHERGQLHEVTVGF
DDEGRVLGLDVRFWHDNGAYTPYGIIVPIITSTQLLGPYKPGAYRVEFWSLYTNTVIVTP
YRGAGRPQGVFAMERVMDAIAEQLGLDRAEVRSRNFIQPSEMPYDHGLLFQDGRPLKYDS
GDFPASLHKLKKLVGWDDFSEYRAAAEAEGRTVGLGIGCYVEGTGVGPYEGGHVQVETSG
RVNVSTGLTSQGQGHETVFAQIVAQELGVRIEDVHVTTGDTRRMPYAVGTFASRAAVMSG
NAIALAARNVRAKALRIAADALEVSVDDLDIADGTVSVRGAPGTAMSLGTVSVLSNPLRY
AFDEAAQAATQFAGTFDPDKPPVADDDEPGLEGKDFYSPTQATFANGMHAAIVETDPVTA
EIRILRYCVVHDCGPMINPMIVEGQVHGGVAQGVGGALYERMDYDSSGQLLNASFMDFLM
PYASEVPEIETDHLETPSPLNPLGIKGAGEAGCIPVSAVIASAIEDAEGFPITRMPISPN
DLWELRRRHAAGELPSLRRARAAHSTDAEPTDAAATNDPTTDPSTQEPSE
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacccagatgttcggcgcgccggtccggcgtcgcgaggacccgcggctcgtcacg
ggaaacgggcgcttcctcgacgacctggggcacgacgcgctcgaggcggcgttcgtgcgc
agcccccacgcccacgcgcggatcgtcgacgtcgacgtggccgacgcgatcgacgtcgag
ggggtcgcgggcatctacgtccatgaggacctcaccggcccgatggccgagccgctcccc
ctgctcatcccccacccgagtctgacccacggccggacggcgcacgccctggcccgggac
gaggtcaaccacgtcggcgaggccgtcgtcatggtcgtcgcgcggaaccgctatgtggcc
gaggacgcctgccagcggatccgcgtcacctacgagcagctgcccgtcgtcgtcggcatc
gagacggcccgcgccggcgagcacctcgtccacgaggacgtgcccggcaacatcgctgcg
cacctgacgcaggaggtcggggacgtggaggcggcgctggtcgcggccccgcacacgctg
acgctcgacctcgccatcgagcggagcgcgtcgatgccgttggagggcaagggcgtctac
gcccgctgggacgacgagcgcggcgagctgcggatgtactcctcgacccagacctcgacc
ggggtgcgcgcggccgtcgcggcccggctcggcctgccgctcgccaaggtcgagtgcatc
gcgccggacgtcggcggggggttcggggtcaagatcatgcacccctggcccgaggaggcc
ctcgtcgcgtggaccgcccgactgctggggcagccggtcaagtggaccgaggaccggcgg
gagcacttcgtctcctcggcgcacgagcgcggacagctgcacgaggtgaccgtgggcttc
gacgacgaagggcgggtgctcgggctcgacgtgaggttctggcacgacaacggcgcctac
acgccctacgggatcatcgtcccgatcatcacctcgacccagctgctcggcccctacaag
ccgggcgcgtaccgggtcgagttctggtcgctctacaccaacaccgtgatcgtcaccccc
taccgcggcgccgggcggccgcagggggtcttcgcgatggagcgcgtcatggacgcgatc
gccgaacagctcgggctcgaccgggcggaggtccggtcgcgcaacttcatccagccgtcc
gagatgccctacgaccacggcctgctcttccaggacggccggcccctcaagtacgactcc
ggcgacttcccggccagtttgcacaagctgaagaagctcgtcggctgggacgacttcagc
gagtaccgcgccgccgcggaggctgagggtcgcacggtcgggctcgggatcggctgctac
gtcgagggaaccggcgtgggaccgtacgagggtggccatgtccaggtcgagacctccggc
cgggtcaacgtgtcgaccggtctgacctcccaggggcaggggcacgagacggtcttcgcc
cagatcgtcgcccaggagctgggcgtgcgcatcgaggacgtccacgtgacgaccggtgac
acgcgccgaatgccctacgccgtcgggacgttcgcctctcgtgccgcggtcatgtcgggc
aacgccatcgccctcgcagcgcgcaacgtccgggccaaggcgctgcggatcgcggccgac
gccctcgaggtgtccgtcgacgacctcgacatcgccgacgggacggtcagcgtcaggggc
gcgcccgggaccgcgatgtccctcggcacggtctccgtcctgtccaacccgctccgctac
gcgttcgacgaggccgcgcaggcggcgacccagttcgccgggaccttcgaccccgacaag
ccacccgtcgccgacgacgacgagcccggcctcgagggcaaggacttctactcccccacc
caggcgaccttcgccaacgggatgcacgccgcgatcgtcgagaccgacccggtcacggct
gagatccggatcctgcgctactgcgtcgtccacgactgcggcccgatgatcaacccgatg
atcgtcgagggccaggtccacggcggggtcgcccagggcgtcggcggggcgctctacgag
cggatggactacgactcgtccggccagctgctcaacgcctccttcatggacttcctcatg
ccgtacgcgtccgaggtcccggagatcgagaccgaccacctcgagaccccgtctccgctg
aaccccttggggatcaagggcgccggtgaggccggctgcatccccgtgtcagccgtcatc
gcctccgccatcgaggacgcggagggcttccccatcacccggatgccgatctcgcccaac
gacctctgggagctgcggcgccggcacgcggctggggagctgccgtcgctccggcgggca
cgagctgcacactcgacggacgcagagccgacggacgcagcggcgacgaacgacccgacg
accgacccttcgacgcaggagccgtcagaatga

DBGET integrated database retrieval system