KEGG   Intrasporangium calvum: Intca_1935Help
Entry
Intca_1935        CDS       T01385                                 

Definition
(GenBank) deoxyuridine 5'-triphosphate nucleotidohydrolase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
ica  Intrasporangium calvum
Pathway
ica00240  Pyrimidine metabolism
ica01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ica00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Intca_1935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ica03400]
    Intca_1935
Enzymes [BR:ica01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     Intca_1935
DNA repair and recombination proteins [BR:ica03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Intca_1935
 Prokaryotic type
    Intca_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase
Motif
Other DBs
NCBI-ProteinID: ADU48446
UniProt: E6SBT7
LinkDB All DBs
Position
complement(2177302..2177871)
Genome map
AA seq 189 aa AA seqDB search
MCRLTRGHWQLEQIGSVHVTDPCACLPPSGDGDAPPGPVVAVRRLDPEVPLPGYAHPGDA
GADLVSRVDVTIAPGERVLVPTGVAIALPPGHAGFVHPRSGLAARHGISIVNAPGTIDEG
YRGEILVNLVNLDRTDAFEVHRGDRIAQLIVQAVARASFVAVDSLDDTVRGDTGHGSTGG
FGPVPPPVD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccgcctgacgcggggccactggcagctcgagcagatagggtcggtccacgtgacc
gacccttgtgcttgcctgccgccctccggcgacggtgacgccccgcccggccccgtcgtc
gccgttcgccggctcgaccccgaagtgcccttgccgggctacgcccatcccggcgacgcc
ggcgccgacctcgtgtcccgggtcgacgtgacgatcgcaccgggggagcgggtcctcgtc
ccgaccggcgtggccatcgcactgccgcccggccacgccggcttcgtccatccacggtcc
gggttggcggcccgccacggcatctccatcgtcaacgcccccggcaccatcgacgagggc
taccggggggagatcctcgtcaacctggtcaacctcgaccggaccgacgccttcgaggtc
caccggggggaccggatcgcccagctcatcgtgcaagcggtggcgcgcgcctcgttcgtc
gccgtcgattcgctcgatgacacggtccggggggacactggacacgggtcgaccggaggt
ttcgggccagtcccacccccggtcgactga

DBGET integrated database retrieval system