KEGG   Intrasporangium calvum: Intca_1963Help
Entry
Intca_1963        CDS       T01385                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ica01001]
    Intca_1963
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Intca_1963
Protein kinases [BR:ica01001]
 Serine/threonine kinases: Other
  Bacterial family
   Intca_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal FA_desaturase RIO1 Sulf_transp DUF4307 Kdo Haspin_kinase Adhesin_P1_N Kinase-like
Motif
Other DBs
NCBI-ProteinID: ADU48474
UniProt: E6SBW5
LinkDB All DBs
Position
2208912..2210822
Genome map
AA seq 636 aa AA seqDB search
MTSSVADALVGREIDGRYRILSHLADGGMASVYVAMDARLDREVALKIMRPGLATDAVFV
ERFRSEARAAARLSHPNVVAVYDQGEDDGDVFLAMELVHGKTLRDVIHEEAPLTAREALA
ILEPVLAALRAAHAAGLVHRDVKPENVIVRHDGEVKVADFGLARAVASEATANQTGVLLG
TVSYLSPEQVEGGAATARSDVYAAGLLLFEMLTGRKAVTGDSPIQIAYRHVHGGVPRPSS
IISAVSADLDELVAQATALDPGDRFPSAAEFLATMRLVRRHLTEGELDRSPVTAPLTFDE
AVHPATNRQAAARAPMRETTAALPLVVGPGPQGRPGWTPRPARARRRRWPWLLAALLLAV
AGAGGWWFTAGPGGTTVVPQAVTHTLDEAAATFKTAALRYESSEAFSETVSKGTVISSQP
AAGTEVAKHSLVLLVVSKGPERYQVPRLVNTKAAALRDALAPLTLKSRSTEDWSETVPKG
AVISQKPAAGTPVKRGAVVEVVVSRGRRPITVPDVRGLPLDEAKAKLTAAGLDVARGDDV
NHDTVPTGHVVSQKPTKGTLFRGDEVTLVISKGPVMVPVPNVVGKPVQEAEATLKELGFT
IEIRRPLGTFFELVRDQSVPADQPAPKGSTIILTVV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccagcgtggcggatgcactcgtcggtcgggagatcgacgggcgctaccgcatc
ctctcccatctcgccgacggtggcatggcctccgtctacgtggcgatggacgcacggctg
gaccgagaggtcgccctcaagatcatgcggcccgggctcgcgaccgacgccgtcttcgtc
gagcggttccgcagcgaggctcgagcggcagcccgcctcagccaccccaacgtcgtcgcg
gtctacgaccagggcgaggacgacggggacgtgttcctcgccatggagctggtgcacggc
aagaccctccgggacgtcatccacgaggaggcgccgctgacggcccgtgaagccctcgcg
atccttgagcccgtgctcgccgcgctccgggccgcccacgccgccggactcgtgcaccgg
gacgtcaagcccgagaacgtcatcgtccgacacgacggcgaggtcaaggtcgccgacttc
ggcctcgcccgggccgtggcgagcgaggcgacggccaaccagaccggggtgctgctcggg
acggtctcgtacctctcgccggagcaggtcgagggcggcgccgccaccgcgcgtagcgac
gtctacgctgccggcctgctcctcttcgagatgctgaccggccgcaaggcggtcaccggc
gacagcccgatccagatcgcctaccgccacgtgcacggcggcgtcccacgtccgtcctcg
atcatctcggcggtctcagcagacctcgacgagctcgtggcgcaggccaccgcgctcgac
ccgggcgaccgcttcccgtccgccgccgagttcctcgccacgatgcgactggtcagacgg
cacctcaccgagggcgagctcgaccgcagcccggtcaccgcgccgctgaccttcgacgag
gcagtccaccctgcgacgaaccgccaggccgctgcccgcgcgccgatgcgcgagaccacc
gccgcgttgcccctggtggtgggcccgggcccgcaggggcgtccgggctggacgccacgc
ccagcccgggcacgccggcgtcgctggccctggctccttgccgccctgctccttgccgtg
gccggtgccggcggatggtggttcacggccggaccgggcgggaccacggtcgtgccccag
gccgtgacgcacaccctcgacgaggccgcagccacattcaagaccgcggctctccgctac
gagtccagcgaagcattctccgagaccgtctcgaagggcacggtcatctcgagccagccg
gcagccggcacggaggtcgccaagcattccctcgtcctgctcgtcgtctccaagggaccc
gagcgctaccaggtgccgcgactcgtcaacaccaaggccgcagcgcttcgcgacgcactc
gcaccgctgaccctcaagagcaggtccactgaggactggagcgagacggtcccgaagggc
gcggtcatctcccagaagcccgccgccggcaccccggtcaagcgcggggccgtcgtcgag
gtggtcgtctcgcgcggccgacgcccgatcaccgtccccgacgtgcgtggcctccccctc
gacgaggcgaaggccaagctcaccgccgccgggctcgacgtggcccgcggcgacgacgtc
aaccacgacaccgtcccgaccggccacgtcgtctcgcagaagccgacgaaaggcaccctc
ttccgcggcgacgaggtcacgctcgtcatctccaagggcccggtcatggtcccggtgccg
aacgtcgtcggcaaacccgtccaggaggccgaggccacgttgaaggagctcgggttcacg
atcgagatccgccgtcccctcggcaccttcttcgagctggtgcgcgaccagagcgtcccc
gccgaccagcccgctccgaagggcagcacgatcatcctcaccgtggtctga

DBGET integrated database retrieval system