KEGG   Intrasporangium calvum: Intca_2020Help
Entry
Intca_2020        CDS       T01385                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kdo RIO1
Motif
Other DBs
NCBI-ProteinID: ADU48531
UniProt: E6SCF2
LinkDB All DBs
Position
complement(2264451..2265962)
Genome map
AA seq 503 aa AA seqDB search
MSAVDSSPPDVPGHLLDRIIGEGASSLVWSGVDQAGEPVAVKVPRPGADPGGHAGAVERH
VLSAVRHPHLVPLREVVPLADGRTALVFDLVTGASLRTMVRTRGQLRPGEAVTILTPLCQ
AVAALHAAGGLHGDVSPGNVMLTAAGRPLLLDLGASHVVGHVGPVWGTEGFVAPEVREGG
PPTSASDIFSLGALAWFCLTGNGAPDTVQRLDPATITSHVGPELTEVIAASIDPDPTARP
SAAHLAGVFYAAVGAEPVEVVVGADDASALTHRLRADAALEAPEPAQRPWAPRRLIVVGA
ALGAVVLAVGGWLLLGGSPAAEASRGQDAPDSAAAVTAPVRPEASTPIVGRTTGRSTDGV
ARRHPGQLQHDVAAPERRTAELLQWLSDRRARALMDRDVDGLAGVHRAGSASHASDVHLV
ETLLASGDRYADLRLSVGSATWVRGDRERATVRARVGWSDYAVVNRSGARRLRPAASGDV
LDFDLRRGPDGWRIEHISVAGST
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgtcgactcgagcccgcccgacgtccccgggcacctactggaccggatcatc
ggcgagggggcctccagcctggtctggtccggcgtcgaccaggcgggcgaaccggtggcg
gtgaaggttccgcgccccggtgcggaccccggtggccacgccggggcggtcgagcgccac
gtgctctcggcggtccggcacccgcacctcgtcccccttcgtgaggtcgtgcccctcgcc
gacgggcgcaccgccctggtcttcgacctggtcaccggcgcgtcgctgcggacgatggtc
cggacccgcgggcagctgcggccgggggaggcggtgaccatcctgacgccgctctgccag
gccgtcgccgcgctgcacgccgcggggggcctccacggtgacgtctcgcccgggaacgtc
atgctcaccgcagcggggcgaccgctcctgctcgacctgggagcctcgcacgtcgtcggc
catgtcgggccggtctgggggacggaaggtttcgtcgctccggaggtccgggaggggggc
cctcccaccagcgcgagcgacatcttctccctcggggcgctggcgtggttctgcctcacc
ggcaacggcgctccggacacggtccagcgtctcgaccccgccaccatcaccagccatgtg
ggtcccgagctcaccgaggtgatcgccgcgtccatcgaccccgaccccacggcgcggccc
tcggcggcgcacctggctggggtgttctacgcggcggtgggggccgagccggtcgaggtc
gtcgtgggcgcagacgacgcctcggctctgacccaccggctgcgggccgatgctgccctc
gaggcaccggagccggcgcagcgcccgtgggccccacggcgactcatcgtcgtcggtgcg
gccctcggcgccgtggtcctggcggtcgggggctggctcctgctcggtggctcgcccgca
gctgaggcctcgcgagggcaggacgccccggactcggcggccgccgtcaccgcgccggtc
cgaccagaggcgtcgactcctatcgtggggaggaccaccgggcggtcgaccgacggggtt
gcccgccgccacccgggccagctgcagcacgacgtcgccgcccccgaacgccggaccgcc
gagctgctgcagtggctgtcggaccgccgcgcgcgagcactcatggaccgcgatgtcgat
ggcctcgccggcgtgcaccgggcaggttcggcatcgcacgcgtccgacgtccatctcgtc
gagaccctgctggccagcggcgaccgctacgccgacctccgactctccgtgggcagcgcc
acctgggtgcgcggggaccgggagcgcgcgacggtgcgggcccgagtgggctggtcggac
tacgccgtcgtcaaccggtccggagcgcgccgactccggccggccgcaagcggggacgtc
ctcgacttcgacctccgccggggcccggacgggtggcggatcgagcacatcagcgtcgca
gggtccacctga

DBGET integrated database retrieval system