KEGG   Intrasporangium calvum: Intca_2044Help
Entry
Intca_2044        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADU48555
UniProt: E6SCH6
LinkDB All DBs
Position
2294762..2295505
Genome map
AA seq 247 aa AA seqDB search
MSEQLKTEPVPSTPRATLLDLSLTQLIAGSMAAATAAALGSRLGVVGTITGAAVGSVVSA
VASSLYRASMMRARAALQWQKAHTRRSRAPLAGVPTTYPSSRVQFVPPHRASSVQHRPAP
HARRVLGGAAAVFALATTFLLGLQLASGTDVTGTSLGDRQAAAQAEPPRPPDPERQAVPA
AADPAPTGRPTDVPATPSSPATTSDPGAPPTGTVPPPPPGPSGPVVTTPPEGPSPSDTPT
SPTTGST
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaactgaagaccgaaccagtcccgtccacccccagagcgacgttgctcgac
ctctccctgacccagctcatcgccggttcgatggctgccgcgaccgcggctgccctcggg
tcgcggctcggcgtcgtcgggaccatcaccggcgctgccgtggggtccgtcgtcagcgcc
gtcgcgtcgagcctctaccgggcgtcgatgatgcgcgcccgcgcggccctccagtggcag
aaagcgcacactcgacgaagtagggcgccgctggccggggtccccaccacctacccctcg
tcgagggtgcagttcgtgccacctcaccgcgcgtcgagtgtgcagcaccgacccgctccc
cacgcgcggcgggtcctgggcggggcggctgccgtcttcgcactggcgacgacgttcctt
ctcgggctgcagctggccagtggaaccgatgtcaccggcacctccttgggcgaccgccag
gcggctgcccaggccgaaccgccgcgaccaccagacccggaacgacaggccgtcccggcc
gccgcggaccccgcccccacgggaaggccgaccgacgtgccggcgacgcccagcagcccc
gcgaccaccagcgatcctggcgcgccgccgacgggcacggtcccgcccccacctcccgga
ccttccggaccagtggtgaccacgccacctgaggggccctcaccgagcgacacccctacc
agccccaccaccggttcgacgtga

DBGET integrated database retrieval system