KEGG   Intrasporangium calvum: Intca_2225Help
Entry
Intca_2225        CDS       T01385                                 

Definition
(GenBank) bacterial translation initiation factor 2 (bIF-2)
  KO
K02519  translation initiation factor IF-2
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ica03012]
    Intca_2225
   03029 Mitochondrial biogenesis [BR:ica03029]
    Intca_2225
Translation factors [BR:ica03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    Intca_2225
 Prokaryotic type
   Intca_2225
Mitochondrial biogenesis [BR:ica03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Intca_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU IF-2 IF2_N MMR_HSR1 GTP_EFTU_D2 Ras SRPRB RsgA_GTPase Roc Arf MMR_HSR1_Xtn
Motif
Other DBs
NCBI-ProteinID: ADU48734
UniProt: E6SE86
LinkDB All DBs
Position
complement(2486395..2489385)
Genome map
AA seq 996 aa AA seqDB search
MAKVRVYELAKELGVESKALLAHLKSQGEFVRSASSTIEPPVVRKIKESFPAELRSGGDA
KPSARTGTPTAPSGGAPAAPRTGAPTAPAAPAAPAAPAPAAPASATPGRPGPAPSRPGPA
APAPSSAPAASAAPAAPAVPAATTAPAAPAAQPAPAAKAAPSGPASAPAARPAAPAPSRP
AAPAARGGAPTPGPRPAPRPSTPRPGNNPFAPSQGMGQTRQRPGDGGPRPGNNPFSPSQG
MPRPQQRPGGPRPGAPAGGSRPGGPGAGGPRPAPRPGGPRPSPGMMPERSTIGRPGQRPA
GPGRPGGPGGPGGAGGRGGFGGGGAGAGAPGGPSRGGFGGGPRGGGPGGRGGTQGAFGRG
GGRPVRGRKSKRAKRQEFEQMQAPSIGGVTVPRGDGKTVVRVRRGTSLTDFADKINANPA
SLVTVLFHLGEMATATQSLDEDTFKLLGVELGYDVQVVSPEEEERELFDSFNIDLETGIE
GEDDEDLEARPPVVTVMGHVDHGKTRLLDAIRNEDVAAGEAGGITQHIGAYQVRKMHEGV
ERPITFIDTPGHEAFTAMRARGAKVTDIAILVVAADDGVMPQTIEALNHAQAADVPIVVA
VNKIDVEGANPSKIRQQLTEYNLVAEEYGGDTMFVDVSAKQGVNIDGLLEAVLLTADAAL
DLRANPEREARGVAIEANLDRGRGATATVLVQTGTLHVGDAIVTGSAYGRVRAMLDEHGK
NVKEAGPSRPVQVLGLSSVPRAGDTFVVAPDDRTARQIAEKREAADRQASLAKARKRISL
EDLNEALAAGKVETLNLILKGDVSGSVEALEDALLKIDVGDEVDLRIIDRGVGAITMNNI
NLAMASNAIIIGYNVRAEGQNADYAEREGVEIRYYSVIYQAIDEVEAALKGMLKPEFEEV
ELGTAEIREIFRSSKFGNIAGSIVRSGEIKRGSKSRITRNGVVISENVEIAGLRRFKDDV
TEVRDGYECGINLGSFNDLQIGDLIATYEMREKPRA
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggtccgggtctacgagctcgcaaaggagctcggtgtagagagcaaggctctg
cttgctcatctcaagagccagggagagttcgtcaggtcggcatcgtcgaccatcgagccc
ccagtcgtccgcaagatcaaggagtcgttcccggcggagctgcgctccggcggtgacgcc
aagccgtccgcgaggaccggcacccccactgcaccgtccggcggtgcgcctgcggccccg
aggacgggtgcacccaccgctccggcggccccagctgctcccgccgcgccggctcccgcc
gcgccggcgtccgccacgcccggtcggccgggacccgctccgagccgccccgggcctgcc
gcgccggcgccctcgtcggctcccgctgcttcggcggctccggccgctcccgctgtcccg
gcggcgaccacagcaccggccgctccggctgcccagccggctcctgcggcgaaggccgcg
cccagcgggcctgcgtctgcccctgcggccaggcctgcggcccccgcccccagtcgcccg
gcggctccggccgctcgcggcggcgccccgaccccggggccgcgtcccgcgccccgtccg
agcacgccgcgaccgggcaacaacccgttcgccccgagccaggggatgggccagaccagg
cagcgtcccggtgatggcggtccccgccccggcaacaatccgttcagcccgagccagggc
atgccgcgtccgcagcagcgccccggtggcccgcgccccggcgcgcctgccggtggctcg
cgtcccggcggtccgggtgccggtggtcctcgtccggccccgcgtcccggtggcccgcgc
cccagcccgggcatgatgcctgagcgcagcacgatcggccgtcccggccagcgtcccgcg
ggccccggccgccccggcggtcccggtggccccggtggcgccggtgggcgcggcggcttc
ggtggcggcggtgccggcgccggtgcgcccggtggtccgagccgcggtggcttcggtggt
ggcccccgtggcggcggcccgggtggccgtggcggcacgcagggcgcctttggccgcggt
ggcggtcgtccggtccgaggccggaagtccaagcgcgccaagcgccaggagttcgagcag
atgcaggcgccgtcgatcggtggcgtcacggtccctcgtggtgacggcaagaccgtcgtg
cgggtgcggcgtggtacgtcgctgaccgacttcgccgacaagatcaacgccaacccggca
tcgctcgtcactgttctcttccacctcggtgagatggcgacggcgacgcagtcgctcgac
gaggacaccttcaagctcctcggtgtcgagctcggctacgacgtccaggtcgtctccccg
gaggaggaggagcgtgagctcttcgactccttcaacatcgacctggagacgggcatcgag
ggcgaggacgacgaggacctcgaggcgcgtccgccggtcgtcaccgtcatgggtcacgtc
gaccacggcaagacgcgcctgctcgacgcgatccgcaacgaggacgtcgcagcgggcgag
gccggtgggatcacccagcacatcggtgcctaccaggtccgcaagatgcacgagggcgtc
gagcgtccgatcaccttcatcgacaccccgggtcacgaggcgttcaccgccatgcgtgct
cgtggtgcaaaggtgaccgacatcgccatcctcgtggtcgcggccgacgacggtgtcatg
ccccagacgatcgaggctctcaaccacgcccaggcggccgacgtgccgatcgtcgtcgcg
gtcaacaagatcgacgtcgagggcgccaacccgtccaagatccgccagcagctgaccgag
tacaacctcgtcgccgaggagtacggcggcgacaccatgttcgtcgacgtgtcggccaag
cagggtgtcaacatcgacgggctgctcgaggcggtcctgctcaccgcggacgccgcgctc
gacctgcgcgccaacccggagcgcgaggcccgcggtgtcgccatcgaggcgaacctcgac
cggggccgcggcgccacggcgacggtgctcgtccagaccggcacgctccacgtcggggac
gccatcgtcaccggctcggcctacggtcgcgtccgcgccatgctcgacgagcacggcaag
aacgtcaaggaggccggcccgtcccgtccggtgcaggtgctcggtctcagctcggtgccg
cgcgccggtgacacgttcgtcgtggcaccggacgaccggactgctcgccagatcgccgag
aagcgtgaggcggccgaccgccaggccagcctggccaaggcccgcaagcgcatctcgctc
gaggacctcaacgaggctctcgcggccggcaaggtcgagaccctcaacctcatcctcaag
ggtgacgtgtcgggttccgtcgaggcgctcgaggacgcgctgctcaagatcgacgtcggc
gacgaggtcgacctgcgcatcatcgaccgcggcgtcggtgcgatcacgatgaacaacatc
aacctcgcgatggcgtccaacgcgatcatcatcggctacaacgttcgggccgagggccag
aacgccgactacgccgagcgcgagggcgtcgagatccgctactactcggtgatctaccag
gccatcgacgaggtcgaggccgcgctcaagggcatgctcaagccggagttcgaggaggtc
gagctcggcacggcggagatccgcgagatcttccgttcgagcaagttcggcaacatcgcc
ggatcgatcgtccgcagcggcgagatcaagcgtggctcgaagtcgcggatcacccgcaac
ggtgtcgtcatctccgagaacgtcgagatcgccgggctgcgtcggttcaaggacgatgtc
accgaggtccgtgatggctacgagtgtggcatcaacctggggtcgttcaacgacctccag
atcggtgacctcatcgccacctacgagatgcgcgagaagccgcgcgcctga

DBGET integrated database retrieval system