KEGG   Intrasporangium calvum: Intca_2499Help
Entry
Intca_2499        CDS       T01385                                 

Definition
(GenBank) Peptidoglycan-binding lysin domain
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM
Motif
Other DBs
NCBI-ProteinID: ADU49005
UniProt: E6S771
LinkDB All DBs
Position
2800468..2801247
Genome map
AA seq 259 aa AA seqDB search
MAGSHGPPTTDEVLGAGLLWGAVALCGWLGITFAILALSAAPGALGRTFCRIADSLTPHC
ARQALALALGASVGTVALPAPAAIAATTAATTAGPTAAGPATSLSTSTSGSPSTGTSGSA
ADSSSGAASALAPAAAGSGVPGPGFAPSHPAHGAVSRTTPAPAPGWVPDRPARVTSPGPG
SLLGGTLRPAGSTIDTVTVRRGDTLWSIAARHLGSGASDSEVAAEWPLWFAANRGVIGDD
PDVVLPGQLLRAPTAEVAP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggccggcagccacggccccccgaccacggacgaggtccttggggcgggtctcctctgg
ggagccgtggccctctgcgggtggctgggaatcaccttcgcgatcctcgcgctcagtgcc
gcgccaggggcgctcgggcggaccttctgccgcatcgccgactcgctgactccgcattgt
gcgcggcaagccctcgcactggcgctgggcgcatcagtgggcacggtggcactgcctgcg
ccggcggccatcgccgcgaccaccgccgcgaccactgccgggcccaccgccgcaggcccc
gcaacgagcctctccaccagcacttccgggagcccttccacgggcacctcaggcagtgct
gccgacagcagttccggcgctgcctccgcgctcgccccagcggcagcggggagcggcgtg
cccggtccgggcttcgcgccgagccatccggcccacggcgccgtgagccgcaccactccg
gcccccgccccggggtgggtcccggaccgtccggcgcgggtgacttctccaggacccgga
tcgcttctcggagggacacttcgaccggccggctcgacgatcgacacggtcaccgttcgc
cgcggcgacacgctgtggtctatcgcagcgcggcacctcggctccggggccagtgacagc
gaggttgcggcggaatggccactgtggttcgcggcgaaccggggggtcatcggcgacgac
cctgacgtcgtgctcccggggcagctcctccgtgccccgacggcggaggtggcaccgtga

DBGET integrated database retrieval system