KEGG   Intrasporangium calvum: Intca_2653Help
Entry
Intca_2653        CDS       T01385                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH RIO1 Kinase-like SSP160 Kdo
Motif
Other DBs
NCBI-ProteinID: ADU49158
UniProt: E6S8J6
LinkDB All DBs
Position
2971240..2972892
Genome map
AA seq 550 aa AA seqDB search
MNQPDVLIAGRYRLLNRVGVGGMGSVWEARDERLQRTVAAKLLHLPPGASAADAENAKNR
AMREARNTARLHHAHAVPVFDVVEHEGQPCLIMQYLPSRTLQQVLDENGPLPPDDVALIG
AEVGSALAAAHAAGIVHRDVKPANVLILDDGSAMITDFGISRALGDATLTAAGMVTGTPA
YLAPEVARGEESSPATDVFSLGATLYAAVEGTPPFGLDPNPMALLHRVASSAATPPTRAG
ALTPVLLAMLADRPSERPSMAAAVEALERVDLTGPAGADPTVAMPAAADPTVAMPVAGAT
QPLRTVPPALPLPGARVAAAGAAVGAGAGASSASGGVTSPRPAADRARVTGTGDPGGSGR
RRSRRGVLVALAVVALVAVGLLAWQALTAGDGRTPSAAPPETTSASSPSTTPSPRTTTSP
RPTTTSAAPTTQSETPPSAPAAPSAAKLSKAVREYYSLLPDDTEEGYALLTERYRSTTAG
SVDTYESFWDSIKKVTVKDVDGSPPGTVEATLTYVFKDGRVFVERTAYGLVEEDGVLKID
SSEVLSSREV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcccgacgtcctcatcgccgggcgctaccgcctgctcaaccgcgtcggcgtc
ggcgggatggggtcggtctgggaggcccgcgacgagcgcctgcaacggaccgtcgccgcc
aagctcctccacctgccacccggcgcgagcgccgcggacgccgagaacgcgaagaaccgc
gccatgcgcgaagcgcgcaacaccgcgcggctccaccacgcgcacgcggtcccggtcttc
gacgtcgtcgagcacgagggccagccgtgcctgatcatgcagtacctgccctcccgcacg
ctccagcaggtgctcgacgagaacggcccgctgccccctgacgacgtggcgctcatcggc
gccgaggtcggctccgcgctcgcggccgcccacgccgccggcatcgtgcaccgcgacgtc
aaaccggccaacgtcctcatcctcgacgacggctcggcgatgatcaccgacttcggcatc
tcccgcgcgctcggcgacgccaccctcacggcggccggaatggtgacgggcacgcccgcc
tacctcgcccccgaggtcgcccgcggcgaggagtcgagccccgcgaccgacgtcttctcg
ctcggcgcgaccctctatgccgccgtggagggcaccccgccgttcgggctcgacccgaac
ccgatggcgctgctgcaccgcgtcgcctcctccgcggccaccccgcccacccgggcgggc
gcgctgacccccgtgctgctcgcgatgctggctgaccggccgtccgagcgaccctcaatg
gcggcggcggtcgaggcgctcgagcgggtggacctgacggggccggccggggccgatccg
acggttgcgatgcccgctgcggccgatccgacggttgcgatgccggtggccggggcgacc
cagccgctgcggaccgtgccgcccgcgctgccgctaccgggtgcgcgcgtggcggctgct
ggggctgctgtgggcgctggtgcgggggcgtcctcggcttcggggggcgtcacttcgcct
cgacctgccgccgaccgcgcgagggtgacgggaacgggcgacccgggcgggtcaggcagg
cggcgctcccgccggggggtcctcgtggccctcgccgtcgtggccctggtggcagtcggg
ctgctggcgtggcaggcgctcaccgcgggcgacggacggaccccgagcgccgcgccgccc
gagacgacctccgcctcctcgccctcgacgacgccgtcgccgaggaccacgacgagcccg
cgcccgacgaccacctccgcggcgccgaccacccagagcgagaccccgccgtcggccccg
gccgcgccatcggccgcgaagctcagcaaggccgtgcgggagtactactcgcttctcccc
gacgacacggaggagggatatgccctgctcaccgagcggtaccgcagcacgaccgccggc
agtgtcgacacctacgagtccttctgggacagcatcaagaaggtgaccgtcaaggacgtc
gacggttccccacctggcaccgtggaggcgacgctgacctacgtcttcaaggacggccgg
gtcttcgtggagcgcacggcctacgggctcgtcgaggaggatggagtcctcaagatcgac
agctcagaggtgctcagcagccgagaggtctga

DBGET integrated database retrieval system