KEGG   Intrasporangium calvum: Intca_2688Help
Entry
Intca_2688        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_6 VWA VWA_3 PGM_PMM_IV Endonuc_BglI DUF3535
Motif
Other DBs
NCBI-ProteinID: ADU49190
UniProt: E6S915
LinkDB All DBs
Position
3006095..3007945
Genome map
AA seq 616 aa AA seqDB search
MDFGGRNETGRDDTTDAPRAGSRRIGPYEASLVDNRERVQQAVKRQQQRRRQVRISVAAA
GAVALVAAGGVGLQLLRDGTPTQLAAPGVVPEAPTSQRVASGCKRPANLTVAVPSAMAPA
FAEVVEAFNAQPGVPCASFTVVPLEASTVAQSLAGPTRPDAWVLDADLWLEQANSRAGLG
LVADEPFAASPVVLAMTGPAADEAEGSGWPQVVAPAEEDLRLVLPDPATSTVGLLSLAAS
AAHLPQSREAGESALRQVAETSGSVPVAASALVAASDPGRNVTTPVSLSELARYNAANPR
SPLTGVAPAEGSPVLEYSLVAVADGTVASRVLRSLRDFLASDEARAVVTTHGFTAPGQPA
AAPAQPGAAPGQPAAAPAQPAAAPSTAATPVRGTVQPLPAPSLAATEKLRDTWAALQPAP
HGILALDTSATTLTRLDGETILDHITRGAQIGLAALSDRSKVGVWLYGQHLGPKGEDHRV
VVAPGALSGAGQLQAIAQGLESLPSVAGGGRGLYDTVIAAVDAARTGGQPGRANTAVVVT
AGPNDDDFGASLGAVKAALRRSSTEPAVRLVIIGVGPKPDAKLLTEVAASAGGTYTAVQQ
AGDLAPAITAALNGGQ
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcggcgggcgcaacgagacaggcagggacgacaccacggacgctcctcgtgcg
gggagccggcggatcgggccctacgaggcctccctcgtcgacaaccgcgagcgcgtgcag
caggccgtgaagcgccagcagcaacggcgacgccaggtgcggatcagtgtcgctgccgct
ggtgccgtcgccctcgtggccgctggcggggtgggtctccagctgctccgcgacgggaca
cccacccagctcgcggccccgggagtcgtccccgaggcaccgacgagccaacgcgtcgcc
tcgggctgcaagcggccggcgaacctcaccgtggccgtcccctccgccatggcgccggcg
ttcgccgaggtggtcgaggccttcaacgcgcagccgggggtgccgtgcgcgagcttcacg
gtcgtcccgctcgaggcgagcaccgtcgcccagtcgctggccgggccgacgcgcccggac
gcctgggtcctcgacgccgacctctggctcgagcaggccaacagccgcgccggcctcgga
ctcgtcgctgacgagcccttcgccgcctcgccggtcgtgctggccatgaccggccctgcc
gccgacgaggccgagggctccggctggccgcaggtggtcgcgccggcagaggaggacctg
cggctcgtcctgccggacccggcgacgtcgaccgtcggcctgctcagcctcgcagcgtcg
gccgcccacctcccccagtcccgagaagccggcgagtcggctctgcgccaggtggccgaa
acgagcggttcggtgcccgtagccgcctcggcgctggtcgccgccagcgaccccggtcgg
aacgtgaccactcccgtgtcgctttccgagctggcccgctacaacgctgcgaacccccgc
tcgccgctgaccggggtcgccccggccgaggggtcgcccgtcctcgagtactcgctcgtg
gccgtggcggacggcaccgtggcctcccgggtcctgcggagcctgcgcgacttcctcgcc
tccgacgaggcccgcgccgtggtgacgacccacggcttcacggcgccggggcaacccgcc
gcggcgccggcgcaacccggagcggcgccggggcaacccgccgcggcgccggcgcaacca
gcggcggcaccctcgacagcggcgacacccgtgcgagggacggtgcagccgctgccggcc
ccgagcctcgcggccaccgagaagctgcgcgacacgtgggccgcactccagccggcgcca
cacggcatcctcgccctcgacacctcggcgaccacgctcacgaggctcgacggggagacg
atcctcgaccacatcacccggggcgcccagatcggcctcgcggcgctgtcggaccgctcg
aaggtcggggtgtggctctacgggcagcacctcggccccaagggagaggaccaccgcgtg
gtcgtcgcgcccggtgcgctgagcggggccggacagctgcaggcgatcgcgcaggggctc
gagtccctgccgtcggtcgcgggcggcggccgcgggctctacgacacggtcatcgccgcg
gtcgacgccgcccggaccgggggccagcccgggcgcgcgaacacggccgtcgtcgtcacc
gccgggcccaacgacgacgacttcggcgcctccctcggtgcggtcaaggcggccctgcgc
cgcagctccaccgagccggccgtgcgcctcgtcatcatcggcgtcggcccgaagccggac
gccaagctgctgaccgaggtcgccgcctcggccggcgggacctacaccgcggtgcagcag
gccggcgacctggccccggcgatcaccgccgccctcaacggcggtcagtga

DBGET integrated database retrieval system