KEGG   Intrasporangium calvum: Intca_2802Help
Entry
Intca_2802        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
  KO
K06994  putative drug exporter of the RND superfamily
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Intca_2802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL
Motif
Other DBs
NCBI-ProteinID: ADU49303
UniProt: E6S9R5
LinkDB All DBs
Position
complement(3118415..3120523)
Genome map
AA seq 702 aa AA seqDB search
MSLTRTSSSSTPPPAPVAPRAAASAPTGGWTGLISRLTSRRGAWATLLIALVVAAGIIGG
LRTEPPVGGGAAGALPASAEAREVADLQTHFASGDQAPALVLWTRADGGPLTPADVSALR
AQAPTISASVGAPRLPPTVAEDGRAALLPVPVDVDRTNGQIAVTIAALRQAAAGPPAGLE
VHVTGGPALGADVASAFDGADLTLLLVTIAAVVLLLLLTYRSPTLWLVPLTVVALADQVA
AVLAAQAGEIWDLRFDAGIISVLVVGAGTNYALLLISRYREELRHQVDHRVALRRAWCST
AGAVVASNVTVVLSLLALLLAALPSTAGLGVAAAIGLLVALAFGLVVLPAALAVTGRGVF
WPFVPQPGAPAPGPSLWGRVAGRSMRRPVLTTLVVLGLLAVLASSLFGTRVGLAPTEKFR
VATESQVGAERLALHFPSGESAPLVVIADEAAIDRVAGVAGQVDGVVSVHPAGASGGLAR
LTVTAEAAPGTTEGERTVRALRAAVHSVAGAEAKVGGEAADLLDTREFADRDLRVVVPVI
LGIVLLVLVALLGAVVGPLVLLTVNALSALAAIGLGSWVGSAALGFAGLDVNVPLLAFMF
LVALGVDYTIFLVHRAREEAIEVGTVEGMRRAVGATGTVITSAGVVLAAVFAALGVLPLM
VLAQMGLIVGLGVLVDTFVVRTLLVPALFALLGDRMWWPRRP
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgacacgcacctcctcgtccagcactcctccacccgctccagtcgccccccgc
gccgccgccagcgccccaaccggcggctggaccggcctgatctcccgcctcacctcccga
cgtggggcctgggcgacgctcctcattgcgctggtcgtggcggccgggatcatcggcggg
ctgcgcaccgagccgcccgtcggaggcggcgccgccggcgccctcccggcgagcgccgag
gcccgcgaggtcgcggacctgcagacccacttcgccagtggcgaccaggcgcccgccctg
gtgctgtggactcgcgcggacggtggcccgctgacgccggcggacgtgtcggcgctccgt
gcccaggcgccgacgatcagcgcgtcggttggtgcgccgcgtctgccgccgaccgtcgcg
gaggacggtcgtgccgctctgctcccggtccccgtcgacgtcgaccgcacgaacggccag
atcgccgtgaccatcgccgcgctgcgacaggcggcggccgggccacccgcgggcctggag
gtgcatgtcaccggtggccccgccctgggcgcggacgtggcgtccgcgttcgacggtgcg
gacctcacgttgctcctcgtgacgatcgccgccgtggtgctcctcctgcttctcacctac
cggtccccgacgctctggctcgtgccgctcaccgtcgtggccctggccgaccaggtcgcg
gcggtcctcgcggctcaggccggtgagatctgggacctgaggttcgatgccgggatcatc
agcgtcctcgtcgtcggcgccggcacgaactacgccctgctcctcatctcgcgctaccgc
gaggagttgcggcaccaggtcgaccatcgggtggccctgcgcagggcctggtgctcgacg
gccggcgccgtcgtcgcgagcaacgtcacggtcgtcctcagcctcctcgcactgctgctc
gccgcactgccctcgaccgccgggctgggagtggccgctgcgatcggcctgctcgtggcg
ctcgccttcggcctcgtcgtgctgcccgcggcgctcgccgtcacgggccggggagtgttc
tggccgttcgtcccgcagcccggcgcgccggcgccggggccgtcgctctggggtcgggtg
gccggacggtcgatgcgcagaccggtgctcacgaccctggtcgtcctcgggctcctcgcc
gtcctggcgtcctcgttgttcggcaccagggtcggcctggcccccacggagaagttccgc
gtcgccacggagtcacaggtcggcgccgagcgcctcgccctccacttcccgtccggcgag
tcggcgccgctcgtcgtcatcgccgacgaggccgccatcgaccgggtggccggggtcgcc
gggcaggtggacggggtcgtgtcggtgcacccggccggagcctcagggggtctcgctcgg
ctgacggtcacggcggaggccgcaccggggacgaccgagggggagcggaccgtgcgtgcg
ctgcgggcagcggtgcactcggtggcaggtgccgaggcgaaggtcggcggcgaggccgct
gacctgctcgacacccgcgagttcgccgaccgcgacctccgggtcgtcgtgccggtgatt
ctcggcatcgtcctgctcgtgctcgtcgccctcctcggtgcggtggtcgggccactggtc
ctgctcacggtgaacgcgctctccgccctcgcggcgatcggtctcggctcgtgggtgggc
agcgccgcgctcgggttcgccgggctggacgtcaacgtgccgctgctcgccttcatgttc
ctggtggcgctcggtgtcgactacacgatcttcctcgtccaccgggcgagggaggaggcc
atcgaggtcgggacggtcgaggggatgcgccgggcggtgggcgccacggggaccgtgatc
acgagcgccggagtggtcctcgctgcagtcttcgccgcactgggcgtgctgcctctcatg
gtgctggcccagatgggcctcatcgtcgggctcggcgtcctcgtcgacaccttcgtcgtc
cggaccctgctcgtgcccgcgctgttcgcgctcctcggcgaccggatgtggtggccgcga
cgcccctga

DBGET integrated database retrieval system