KEGG   Intrasporangium calvum: Intca_2907Help
Entry
Intca_2907        CDS       T01385                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal RIO1 Kdo ABC1
Motif
Other DBs
NCBI-ProteinID: ADU49402
UniProt: E6SAU1
LinkDB All DBs
Position
complement(3225075..3226913)
Genome map
AA seq 612 aa AA seqDB search
MAAHDRTHWVPAPPAGPRRTGPDGAPEDGRPRHERLGRYRLVEEIGEGGMGVVHLGLDPR
GRAVAIKVLRPHVATDDEARLRLQREVETLSRIQDHRVATVIDADVMAPRPYIVTRYVPG
PALDDWVEAHGPLDPDALLRLACGTAEAIRAIHASGVVHRDIKPGNVLLEDGEPVLIDFG
IAHIEDDVRHTMGGLVMGTPGYLSPELVEGAAITDATDWWGWAATITFAASGRPPFGRGR
MDVVLAKVRAGEVDLDGVDPRLVPLLRASLSPQPAGRPHADDVIDALARFAAGRAATVPT
PRGGPWDDTVAVAPSPVGSTEVLHPRGTAVYPTVPDVPRAAGAAAGTPSAGFPAAVLPPA
PGPPGPPAGRTPARAWPAPRAGASPAAYGRLEEADDWGTDDDYEDYDDSYLPPREGDPRI
GLAKRTGTLAAVALAWLGALAFWPGAAVVGLVAWSVLARAVDRAMTGLVLRRFEYGRRQS
DVPWTVVTSPWHLVVGLVATVVSLLLPVAVAFAGVFSAALLLSGVAGSDLDPGTPGTLLV
GGALGLLMLWWGPGRASLRRGTRSVVRRFVPPGPPTQVVAVVLAGAGVAVALVGITRGVS
SWAPFGAGPFGL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcacgaccggacccactgggtgcccgcacccccagcggggccgcggcgcacc
ggaccggacggcgcgcccgaggacggccgcccccggcacgagcggctcggccgctaccgc
ctcgtcgaggagatcggcgagggcgggatgggcgtcgtgcacctcggcctcgacccccgt
gggcgggccgtcgcgatcaaggtgctccgcccccacgtcgccacggacgacgaggcgcgc
ctgcgcctgcagcgggaggtcgagacgctgtcccggatccaggatcaccgcgtcgccacc
gtcatcgacgcggacgtcatggcgccgcgtccctacatcgtcacccgctacgtcccgggc
ccggcgctggacgactgggtcgaggcccacggcccactcgacccggacgcgctgctgcgc
ctcgcctgcggcacggccgaggcgatccgcgccatccacgccagcggcgtcgtccaccgg
gacatcaagccgggcaacgtcctcctcgaggacggcgaaccggtcctcatcgacttcggc
atcgcccacatcgaggatgacgttcgtcacacgatgggcggtctcgtcatggggacgccg
ggctacctgtctcccgagctcgtcgaaggggcggccatcaccgatgcgacggactggtgg
ggctgggccgcgacgatcaccttcgccgcgtcggggcggccaccgttcggccggggtcgg
atggacgtcgtgctggcgaaggtccgcgccggggaggtcgacctcgacggcgtcgacccc
cgtctggtcccgctgctgcgggcctccctctcgccccaacctgccgggcgtccgcacgcc
gacgacgtcatcgacgccctggcccggttcgccgccggccgtgccgcgacggtgccgact
ccccgtggcggtccctgggacgacaccgtggcggtcgcgccctcgccggtggggtccacg
gaggtcctccacccgcgcgggaccgccgtctaccccacggtccctgacgtgccccgagct
gcgggcgctgccgctggaactccttccgccgggttccccgctgcggtcctgcccccggcg
ccgggaccgcccgggccgcccgccggtcggaccccagcccgcgcctggcccgcgccgcgc
gcgggagcgagcccagcggcatacggccggctggaggaggccgacgactgggggaccgac
gacgactacgaggactacgacgactcctacctgccaccacgggaaggagacccccggatc
gggctggcgaagcgcaccggcacgctcgccgcggtggcgctggcatggctcggagcgctg
gcgttctggcccggggccgctgtcgtcgggctcgtcgcgtggtccgtcctcgcccgcgcc
gtggaccgcgccatgacggggttggtgctgcgccggttcgagtacgggcggcgtcagagc
gacgtcccctggaccgtcgtcacgagcccgtggcacctcgtcgtcggcctcgtcgcgacc
gtcgtgtccctcctgctgccggtcgccgtcgcgttcgccggcgtgttctcggcggcgctg
ctgctcagcggggtggccgggagcgacctcgatcccggcaccccaggcacgctgctcgtg
ggaggcgcgctcgggctcctcatgctgtggtgggggccgggccgggcctcgctccgccgc
gggacgcgctcggtggtgcgacggttcgtcccgcccgggccccccacgcaggtcgtggcg
gtcgtcctggccggggccggggtcgcggtcgccctcgtggggatcacccgcggcgtgagc
agctgggcgccgttcggcgcaggacccttcgggctctga

DBGET integrated database retrieval system