KEGG   Intrasporangium calvum: Intca_3277
Entry
Intca_3277        CDS       T01385                                 

Definition
(GenBank) Exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
ica  Intrasporangium calvum
Pathway
ica03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ica00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Intca_3277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ica03400]
    Intca_3277
Enzymes [BR:ica01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     Intca_3277
DNA repair and recombination proteins [BR:ica03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     Intca_3277
SSDB
Motif
Pfam: Exo_endo_phos DUF1409
Other DBs
NCBI-ProteinID: ADU49760
UniProt: E6SDS9
LinkDB
Position
3615121..3615912
AA seq 263 aa
MRIATWNVNSIRSRVDRVTDWLVRSDVDVLALQETKAREDQFPHDRFRELGYEVAHHGLS
QWNGVAIVSRVGIEDVRVGFDGMPGWGDPAAAEARAIGALCGGVRIWSLYIPNGRTLEDP
HLLYKLDWLAALADAGRSWLADDPSAPIALLGDWNIAPFDEDVWSVPFYEGRTHTSPRER
AAFQAVVDAGFADVVRPHCPGPGVYTYWDYVQLRFQKGRGMRIDFALCSPALARRVTGAA
IDREARKGKGASDHAPVVFEIED
NT seq 792 nt   +upstreamnt  +downstreamnt
gtgcggatcgccacctggaacgtcaactccatcaggtcccgggtcgaccgggtcaccgac
tggctcgtccggagcgacgtcgacgtcctcgccctgcaggagaccaaggcgcgcgaggac
cagttcccgcacgaccggttccgggagctgggctacgaggtggcccaccacggactgtcc
cagtggaacggggtggccatcgtgtcgcgcgtcgggatcgaggacgtgcgggtcggcttc
gacgggatgcccggctggggagaccccgccgccgccgaggcgcgcgcgatcggcgcgctc
tgcggtggagtgcggatctggtcgctctacatccccaacggccgcaccctcgaggacccg
cacctgctctacaagctcgactggctggccgcgctcgccgacgcaggccgctcgtggctc
gccgacgacccgagtgcgccgatcgcgctgctcggcgactggaacatcgcccccttcgac
gaggacgtgtggagcgtgccgttctacgaggggcgcacgcacacgtcgcctcgcgagcga
gctgccttccaggccgtcgtggacgccgggttcgccgatgtcgtccggccgcactgcccg
ggccccggggtctacacgtactgggactacgtccagctccgcttccagaagggccgcggg
atgcgcatcgacttcgcgctgtgctcacccgcgctcgcccggcgggtgaccggcgcagcg
atcgaccgcgaggcgcgcaagggcaagggcgccagcgaccacgcgccggtggtcttcgag
atcgaggactga

DBGET integrated database retrieval system