KEGG   Intrasporangium calvum: Intca_3479Help
Entry
Intca_3479        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HC2 CwsA Voltage_CLC
Motif
Other DBs
NCBI-ProteinID: ADU49957
UniProt: E6SG03
LinkDB All DBs
Position
3854791..3855501
Genome map
AA seq 236 aa AA seqDB search
MSADGEETHVLLGGYVLGGLSDEDHRAFTEHLRTCPACQAELGQVSGLPRLLSLVERPPT
EEPYAAGLAPGEEAPEVGAGSAAAGPPTLPGLTDLLAEARRRRRRRRDWLVAAAGVAAAG
AFGAGAWLGPGLLDPPPPSEHYTATAPAGSTAQVGVHLVTRGWGTQLDLACSNMPVGEEI
TLYVIDAAGRESPAGSWLGTRSGYATVTGATALRPEQIRSIEVRTADGTLIAAVRT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacggcgaggagacccacgtgctgctgggcggctacgtcctcggcgggctg
tccgacgaggaccaccgcgcgttcaccgagcacctgcgcacgtgccccgcgtgccaggcg
gagctcggccaggtctccgggctcccccggctgctctcgctcgtcgagcgaccaccgacc
gaggagccgtatgccgctgggctcgctcccggagaggaggcacccgaggtgggggccggg
tccgctgcggcgggtccgcccaccctgccgggcctcaccgacctcctggccgaggcacgg
cggcgccgtcgacggcggcgggactggctggtcgccgcggcgggcgtcgccgccgcgggg
gccttcggcgccggagcctggctgggccccgggctgctcgacccgccgcccccgtccgag
cactacacggcgaccgcacccgccgggtcgacggcgcaggtcggggtccacctcgtcact
cgagggtggggcacccagctcgacctcgcctgctcgaacatgccggtcggcgaggagatc
accctctacgtcatcgacgcggccgggcgcgagtcgccggccgggtcctggctggggacg
cgatccggctacgccaccgtcaccggggcgacggcgctgcggccggagcagatccggtcc
atcgaggtgcgcacggcggacgggaccctcatcgcggccgtgcggacctga

DBGET integrated database retrieval system