KEGG   Intrasporangium calvum: Intca_3527Help
Entry
Intca_3527        CDS       T01385                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ADU50001
UniProt: E6S6I4
LinkDB All DBs
Position
3891964..3893364
Genome map
AA seq 466 aa AA seqDB search
MSTPVTWEELPDTDPRALTVRTVPALIDARGDAWAGIDEAVGDVARAIALWDRDVERGLG
ELNFPPDYPKMPGEPPRVQPSKRRQDKADAEYMAPKAERDADLRALWGPVPPPVAPMLAK
AVKDFGAVKGTVVYEPKWDGFRSIIFRSGDEVEIGSRNEKPMTRYFPEIVEAVKASFPER
AVIDGEIILIDPTEGNRLDFELLQQRIHPAASRVRKLAAETPASFVAFDLLALGDEDYRG
RPFSERRAALEGALAGAEAPVHLTAMTADQSVARDWFDQFEGAGLDGVIAKPVDVRYEPE
KRLMFKVKHERTADCVVAGYRTHKTDPTAIGSLLLGLYDGEGNLASVGVIGALPMARRRE
LYEELQPLVAEWDEHPWNWAKPEEGVRTPRSSEYSRWNNQKDLSFTPLRPERVVEVRYDH
MEGTRFRHTAQFVRWRPDRTPESCTFAQLEEPVGYDLADVLSAGRD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacgccggtcacgtgggaggagctgcccgacaccgacccgagggccctgacggtc
cggaccgtccccgccctcatcgacgcccgcggcgacgcctgggccggcatcgacgaggcc
gtcggcgacgtcgccagggccatcgccctgtgggaccgggacgtcgagcgtggtctcggt
gagctgaacttcccgcccgactacccgaagatgccgggtgagccgccgcgcgtgcagccg
agcaagcggcgccaggacaaggccgacgccgagtacatggcacccaaggccgagcgggat
gccgacctgcgggcgctctggggacccgtccccccgcccgttgcgccgatgctcgccaag
gcggtcaaggacttcggggcggtcaaggggaccgtcgtctacgagccgaagtgggacggc
ttccggtcgatcatcttccgctccggcgacgaggtcgagatcggcagccgcaacgagaag
ccgatgacgcgctacttccccgagatcgtcgaggcggtcaaggccagcttccccgagcgc
gccgtcatcgacggcgagatcatcctcatcgacccgactgagggcaaccggctcgacttc
gagctgctccagcagcggatccaccccgcggcgtcgcgggtgcgcaagctggctgcggag
acgccggccagcttcgtcgccttcgacctgctcgcgctcggcgacgaggactaccggggc
cggccgttcagcgagcgccgggcggctctcgagggggcgctcgccggggccgaggccccg
gtccacctcacggccatgaccgcggaccagtccgtcgcgcgggactggttcgaccagttc
gagggagccggcctggacggcgtcatcgccaagccggtcgacgtccgctacgagccggag
aagcggctgatgttcaaggtcaagcacgagcgcaccgcggactgcgtcgtcgccggctac
cgcacccacaagacggacccgacggcgatcggctctctcctgctcggtctctacgacggc
gagggcaacctcgccagcgtcggtgtcatcggcgccctgccgatggcgcggcggcgcgag
ctctacgaggagctccagccactcgtcgccgagtgggacgagcacccgtggaactgggcc
aaacccgaggagggtgtccgcacgccgcgctcgtccgagtactcccggtggaacaaccag
aaggacctgtccttcacgccgctccgcccggagcgggtcgtcgaggtccgctacgaccac
atggagggcacccgcttccgccacacggcccagttcgtccgctggcgccccgaccgcacg
cccgagtcgtgcaccttcgcgcagctcgaggagccggtcggctacgacctcgccgacgtc
ctctccgccggccgcgactga

DBGET integrated database retrieval system