KEGG   Intrasporangium calvum: Intca_3634Help
Entry
Intca_3634        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F5_F8_type_C
Motif
Other DBs
NCBI-ProteinID: ADU50107
UniProt: E6S7E4
LinkDB All DBs
Position
4005889..4007751
Genome map
AA seq 620 aa AA seqDB search
MTHVHGVGPGTLLGARYAVTLRTSESRTHERWRAADHTLDREVVLVCFPVGSSVAAAALD
AARRAAGIEDSRLTRVLDVGIDGDVAFIVEEPLTGAVPMSHLLQSGGLPAEEVRRLVGET
ASALERARHRGLHHLVLTPSSILRLPDGDVKVRGVATEAALTDADQVSDEHASRVDAVGL
VKLIYAGLTARWPTGPGAASHARPVGLEPAPSLVGGVAAPSEIAVGIPNDLDLICRMTLN
EDRGPISPGDLALQIAPWPSEPYSRLSPSARREGSGSATAAAADAAAAGSAAPVTESAGA
AGGGAAGGGAVAGGAVAGGAVAGAAAGLSAAGAAAAGAASAIGDRVGSFARAAAERAARG
AERLSGPDGDRFEGEDIALTDALDDAPPTRLEPPLPVFGGGPDRPSGAQSRIALAIVGAL
VLVALVIGINNVAKIGESDSSAQARPTVTVTRSTPAPSTTATGSSAPTTKTETPPPEPVR
IIGGSSFDPQDDGEESPRQVPLAFDGDPGTAWKSRWYGTDTYNRSKEGVGLVLDLSAPTV
VREVELTLPAAQDVTIYLTDEARLEGAQQIGRVTGTSGTVTIKAPRDIQAGSKLIIWVTR
PAPDEAPNHHRAQIAEVVVR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacgtgcacggagtcggaccagggacactcctcggcgcacggtatgccgtcacc
ctgcgcacgtccgagagccgcacccacgagcggtggcgggccgcggaccacaccctcgac
cgtgaggtcgtcctcgtctgcttccccgtggggtcgtccgtcgccgccgccgctctcgat
gccgcccgccgcgctgccgggatcgaggactcccggctgacccgggtgctcgacgtcggc
atcgacggtgacgtcgccttcatcgtcgaggagcccctgaccggagccgtcccgatgtcc
cacctgctccagtccggcggcctgccggccgaggaggtccggcggctcgtcggggagacc
gcgagcgccctcgagcgggcccggcaccgtggactgcaccatctggtgctcaccccgtcg
tccatcctgcgcctccctgacggcgacgtgaaggttcgcggcgtcgcgacggaggccgcg
ctgaccgatgccgaccaggtctcggacgagcacgcctcccgggtcgacgcggtgggcctc
gtcaagctgatctatgccgggctgaccgcccgttggccgacgggaccgggagcggcgagc
cacgcgcgtcccgtggggctcgagccggcccccagcctcgtcggcggcgtggcagccccc
tcggagatcgccgtcggaatcccgaacgacctcgacctgatctgccggatgaccctcaac
gaggaccgcgggccgatctcacccggcgacctcgcgctccagatcgctccttggccctcc
gagccctactcgcgcctgtcccccagcgcccgtcgtgagggctcaggttccgccacggcg
gctgctgccgacgcggcggctgccggctccgctgctccggtgaccgagtccgctggtgcg
gccggcggcggagcggccggcggcggagcggtggccggcggagcggtggccggcggagcg
gtggccggcgcggccgccggtctctcggccgccggtgcggcggctgcgggagctgcgagc
gccatcggtgaccgggtcggctcgttcgcccgcgctgcggcggaacgcgcggcccggggt
gccgagcggctctccggtcctgacggcgaccggttcgagggtgaggacatcgccctcacg
gacgccttggacgacgcaccgccgacgcgtctcgagccgcccctgccggtcttcggtggc
ggaccggatcgaccctctggtgcgcagtcacggatcgcgctcgcgatcgtcggtgccctc
gtcctcgtcgcgctcgtcatcgggatcaacaacgtcgccaagatcggtgagtccgacagc
tccgcccaggcgcggccgacggtcacggtgacgcggagcacgcctgctccgtcgacgacg
gccaccgggtcctcagcgccaacgacgaagaccgagacgccgcctccggagccggtccgc
atcatcggcggatcgagcttcgacccccaggacgacggcgaggagagcccgcgccaggtc
cccctcgccttcgatggtgacccggggacggcgtggaagtcgcgctggtacggcaccgac
acctacaaccgcagcaaggagggcgtcggtctggtcctcgacctcagtgcgccgaccgtg
gtccgtgaggtggagctgactctcccggcggcccaggacgtcaccatctacctcaccgac
gaggctcggctcgagggcgcccagcagatcggcagggtcacgggcacgagcggcaccgtg
acgatcaaggctccgcgggacatccaggccggcagcaagctcatcatctgggtcacgcgt
ccggcgccggacgaggcaccgaaccaccaccgcgcgcagatcgccgaagtggtggtgcgc
tga

DBGET integrated database retrieval system