KEGG   Isoptericola dokdonensis: I598_0394Help
Entry
I598_0394         CDS       T04384                                 

Gene name
spk1
Definition
(GenBank) Serine/threonine-protein kinase PK-1
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ido  Isoptericola dokdonensis
Brite
KEGG Orthology (KO) [BR:ido00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ido01001]
    I598_0394 (spk1)
Enzymes [BR:ido01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     I598_0394 (spk1)
Protein kinases [BR:ido01001]
 Serine/threonine kinases: Other
  Bacterial family
   I598_0394 (spk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like ABC1 Pkinase_fungal RIO1 Haspin_kinase Kdo
Motif
Other DBs
NCBI-ProteinID: ANC29982
UniProt: A0A168EFX4
LinkDB All DBs
Position
complement(418053..420065)
Genome map
AA seq 670 aa AA seqDB search
MATTTTDPQLGRLVDGRYEIVARVARGGMATVYRARDRRLGREVAVKIMHPHLAEGVDGA
SFVSRFRREARASARLSHPGVVAVFDQGVDGDTSYLTMEYVPGHNLRAELREGPLRADRA
LDVAAQVLAALAAAHRVGLVHRDVKPENVLVDDEDRVKVADFGLARAVTEVTSTATGTIL
GTVAYLAPEVITSGGCTPATDVYAVGVLLHEMLTGALPYPGETPVQVAFRHVHEDLPPPS
ERVPWLPAEVDALLASFTARDPARRPAHAGVALAALRALRTGLPDDVLDRTADPVVPGTT
TAGSALSPVDEAAADDATTSPPGPAVGAGSADDVDEIPAAFFADVVPTGHVTEHVVTAPT
TAMPHDVPVRRPRRRRRAAVAWLCVAVLLAGGGVGGWWWFADGPGAWTDVPAGLVGAEAE
DAQAALDAAGLAGRTTEAFDDEVAEGDVVSTEPGAGEPVRRDGAVTLVVSLGVEMLTVPT
GLVGSAQRDAEAALEDAGFTVGPSGGAYDDEAPEGEVLEVSVEEGAREPHDTEVRLTVSQ
GPAPVQVPQVVGRSAQDAEQDLAAAGLRVDHADPEHSTEVAEGHVLAQDPEQGSDARRTD
TVTLTLSAGPREVKVPDVVGMSEQEASDALADAGFEVDVNRYLGGLLDTVRFQDQTGKAP
EGSTVTLTVW
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccacgacgactgatcctcagctcggccgcctggtcgacgggcggtacgagatc
gtcgcgcgcgtggcccgcggtggcatggccacggtctaccgggcccgggaccgccgcctc
ggccgcgaggtcgcggtgaagatcatgcacccgcacctcgccgagggcgtggacggcgcg
agcttcgtctcccggttccggcgcgaggcgagggcgtcggcgcggctgtcgcaccccggg
gtcgtcgcggtgttcgaccagggcgtcgacggcgacacgagctacctgacgatggagtac
gtcccgggccacaacctgcgtgccgagctgcgcgagggcccgctgcgcgccgaccgggcg
ctggacgtcgccgcgcaggtgctggccgcgctcgccgccgcccaccgggtcgggctcgtg
caccgcgacgtcaagccggagaacgtgctcgtcgacgacgaggaccgcgtcaaggtcgcg
gacttcgggctggcgcgggccgtcaccgaggtgacgtccaccgccaccgggacgatcctc
gggaccgtcgcctatctcgcgcccgaggtgatcacctcgggcgggtgcaccccggcgacc
gacgtctacgccgtcggtgtgctgctgcacgagatgctcaccggagcgctcccctacccc
ggcgagacgccggtgcaggtcgccttccggcacgtccacgaggacctgccgccaccgtcg
gagcgggtgccgtggctgccggcggaggtcgacgccctgctcgcgtcgttcaccgcccgc
gacccggctcgccggcccgcccacgccggggtggcgctggccgcgctgcgcgcgctgcgg
accggtctgcccgacgacgtcctcgaccgcaccgccgacccggtcgtgccgggcacgacg
accgcaggctcggcgctctcaccggtggacgaggccgccgccgacgacgccaccacgtcg
ccgccgggacccgcggtcggcgccggctccgcggacgacgtcgatgagatccccgcggcg
ttcttcgccgacgtggtcccgaccgggcacgtcaccgagcacgtcgtcaccgcaccgacc
acggcgatgccccacgacgtcccggtgcgccgtccccgccgacgccgacgcgccgcggtc
gcctggctgtgcgtggcggtgctcctcgccggaggcggcgtcggcggctggtggtggttc
gccgacgggcccggggcgtggaccgacgtgcccgccggcctcgtcggcgcggaggccgag
gacgcgcaggcggccctcgacgccgccggcctggcaggccgcaccacggaggcgttcgac
gacgaggtcgccgagggtgacgtcgtgagcaccgaacccggtgccggcgagcccgtgcgt
cgcgacggcgccgtcaccctcgtggtctccctgggggtcgagatgctcaccgtcccgacc
ggtctggtcgggtccgcgcagcgcgacgccgaggccgccctggaggacgccggtttcacg
gtcggcccctccggcggagcgtacgacgacgaggcgcccgagggcgaggtgctcgaggtg
tccgtcgaggagggggcgcgcgagccgcacgacaccgaggtgcgcctcaccgtctcccag
ggtcccgcgccggtgcaggtgccccaggtggtcggccggtcggcgcaggacgccgagcag
gacctcgccgccgccgggctgcgcgtcgaccacgccgacccggagcactccacggaggtc
gccgagggccacgtcctggcgcaggaccccgagcagggcagcgacgcccggcgcaccgac
accgtcacgctcaccctgtccgcggggccgcgcgaggtgaaggtgcccgacgtcgtcggg
atgtccgagcaggaggcctccgacgccctcgcggacgcggggttcgaggttgacgtgaac
cgctacctcggcggcctgctcgacacggtgcggttccaggaccagaccggcaaggccccc
gaggggagcaccgtgaccctcacggtctggtga

DBGET integrated database retrieval system