KEGG   Isoptericola dokdonensis: I598_1939Help
Entry
I598_1939         CDS       T04384                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ido  Isoptericola dokdonensis
Pathway
ido00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ido00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    I598_1939
Enzymes [BR:ido01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I598_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_2_C Glyco_hydro_35 Cellulase Glyco_hydro_14 ThuA DUF4350
Motif
Other DBs
NCBI-ProteinID: ANC31486
UniProt: A0A168FDY6
LinkDB All DBs
Position
complement(2060153..2062198)
Genome map
AA seq 681 aa AA seqDB search
MAVTTWPTGSALGYGGDYNPEQWPRETWDADVALMAEAGVNFVSVGIFSWAMLEPREGEH
DFAWLDELLDLLHSRGIMVDLATPTAAPPAWFFATYPEARVVTRDGVPMGPGSRGAASPS
HPAYQRAARDIASRIAERYADHPAVVMWHVHNEYGAPVGEDFSEAALTAWRIWLRQRYGT
LDGLNAAWGTKFWGQVYGEWEHVMLPGPTPSVRNQAQVLDFARFTDHQLRALFVAERDAI
RRYSDKPVTTNFMANECPTTDLWAWAREVDVVSNDHYLTAADPRAHVGLALAADLTRSVA
GGRPWILMEHSSSGVNWQPRNIAKRPGEMARNSLSHVARGADVVGFFQWRASRVGAEKFH
SAMLPHAGTDSRVWREVVDLGAHVGALAPVQGSTVRADVALLWDTESHWAQDQEWRPSVD
LTHRERTRAYYERLWRDGVTTDFAHPEADLSGYRLVVAPASYLLTAAAAANLTRYVEAGG
TLVVSCFSAVVDEHDAVHAGGFAAPLRDVLGVRVQEFLPLREAESTKVAWSGSAESAGRT
LAASVWHEHVTPVGAETVATHLDGPAAGMPAVTRNAHGAGHAWYVATVLDVTELATVLGD
VYADAGVTPSGLAEDLEVVVRRADDADYTFAINHTDSPAVVPGVTGTALGDGTDVGPDLT
VPAGDVVVVRTPATPGGDPAS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcacgacctggccgaccggctccgcgctcggctacgggggcgactacaacccc
gagcagtggccccgcgagacgtgggacgccgacgtggccctcatggcggaggccggcgtc
aacttcgtcagcgtcgggatcttctcctgggcgatgctcgagccccgcgagggcgagcac
gacttcgcctggctcgacgagctgctcgacctgctgcactcccgcggcatcatggtcgac
ctcgcgacgccgacggcggcgcctccggcctggttcttcgccacctaccccgaggcgcgc
gtcgtcacccgcgacggcgtcccgatgggtcccggctcccgcggcgcggcgtccccgtcg
caccccgcctaccagcgcgccgcccgcgacatcgcgtcgcgcatcgccgagcgctacgcc
gaccaccccgccgtcgtcatgtggcacgtccacaacgagtacggcgcccccgtgggcgag
gacttctcggaggccgcgctgaccgcctggcggatctggctgcggcagcgctacggcacc
ctcgacgggctcaacgcggcctggggcacgaagttctggggccaggtctacggcgagtgg
gagcacgtcatgctccccggcccgacgccgtcggtgcgcaaccaggcgcaggtcctcgac
ttcgcacggttcaccgaccaccagctccgcgcgctgttcgtcgccgagcgcgacgcgatc
cgccggtactccgacaagccggtcaccacgaacttcatggcgaacgagtgccccaccacc
gacctgtgggcgtgggcgcgcgaggtggacgtcgtctccaacgaccactacctcaccgcc
gcggacccgcgcgcccacgtcggcctggccctggccgccgacctcacccgctccgtcgcg
ggcgggcgtccgtggatcctcatggagcactccagctccggcgtgaactggcagccccgc
aacatcgccaagcggccgggggagatggcgcgcaactcgctgtcccacgtcgcccgcggc
gccgacgtcgtcgggttcttccagtggcgcgcctcccgggtgggcgccgagaagttccac
tcggcgatgctgccgcacgccggcaccgactcccgggtgtggcgcgaggtcgtcgacctc
ggcgcgcacgtgggtgcgctggcgcccgtccagggctccaccgtgcgcgcggacgtcgcg
ctgctgtgggacaccgagtcccactgggcgcaggaccaggagtggcggccgtcggtcgac
ctcacgcacagagaacggacgcgcgcctactacgagcggctgtggcgcgacggcgtgacg
accgacttcgcgcaccccgaggcggacctgtcggggtacaggctggtcgtcgccccggcg
tcgtacctgctcaccgcggccgcggcggcgaacctcacccggtacgtcgaggcgggcggc
accctggtcgtgtcctgcttctcggcggtcgtggacgagcacgacgccgtgcacgccggc
ggtttcgccgcgccgctgcgcgacgtcctcggcgtccgcgtccaggagttcctgccgctg
cgcgaggccgagtcgacgaaggtcgcgtggagcgggtccgccgagagcgccgggcgcacg
ctcgccgcgagcgtctggcacgagcacgtcacccccgtgggtgccgagaccgtcgccacg
cacctcgacggccccgccgccgggatgcccgccgtgacccggaacgcccacggcgccggg
cacgcctggtacgtcgccacggtcctggacgtcaccgagctcgccaccgtcctgggcgac
gtctacgccgacgcaggcgtcacgccgtcggggctcgccgaggacctggaggtcgtcgtc
cggcgcgccgacgacgcggactacaccttcgcgatcaaccacaccgactccccggccgtc
gtgcccggggtcaccgggacggcgctgggcgacgggaccgacgtcggccccgacctgacc
gtccccgcgggcgacgtcgtcgtcgtgcgcacccccgcgacgcccggaggtgatccggcg
tcctga

DBGET integrated database retrieval system