KEGG   Isoptericola dokdonensis: I598_2031Help
Entry
I598_2031         CDS       T04384                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ido  Isoptericola dokdonensis
Pathway
ido00020  Citrate cycle (TCA cycle)
ido00480  Glutathione metabolism
ido01100  Metabolic pathways
ido01110  Biosynthesis of secondary metabolites
ido01120  Microbial metabolism in diverse environments
ido01130  Biosynthesis of antibiotics
ido01200  Carbon metabolism
ido01210  2-Oxocarboxylic acid metabolism
ido01230  Biosynthesis of amino acids
Module
ido_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ido_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ido00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I598_2031 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I598_2031 (icd)
Enzymes [BR:ido01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     I598_2031 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ANC31574
UniProt: A0A161II79
LinkDB All DBs
Position
2156158..2158389
Genome map
AA seq 743 aa AA seqDB search
MTTEPQAAAGKIIYTFTDEAPLLATFSFLPIVQAYAAQAGVDVDTRDISLAGRILAQFPE
SLTAEQRVDDALAELGRMATTPEANIIKLPNISASVPQLKAAVAELQSQGFAIPDYPENP
STDAEREARAKYDKVKGSAVNPVLREGNSDRRAPGAVKNYAKAHPHRMGAWSADSKTAVA
TMGEHDFFANEKSVTVPAADTLTIRLRTADGTTVLKDGLQVEAGEVVDATFMSVAALRTF
LAEQVERARAEGVLFSAHLKATMMKVSDPIVFGHVVETFLPQVFERYGADLEAAGLSARD
GLGGILAGLDALDNGAEIRAAIEQGLADGPALAMVDSDKGITNLHVPSDVIIDASMPAMI
RIGGHMWGPDGAEHDTLAVIPDSSYAGVYQAVIDDCKAKGALDPATMGSVPNVGLMARKA
EEYGSHDKTFEIPTDGTVEVVNAAGEVLISHDVAAGDVWRACQTKDAPIRDWVGLAVRRA
RESGTPAVFWLDADRAHDAQLLLKLEQYLPEHDTEGLEILVMNPAEATRYSLDRIREGLD
TISVTGNVLRDYNTDLFPILEVGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLLAEN
YLRWDSLGEFFALAASFEHLARVEGNAGAKVLADTLDRATETFLNEDRSPTRRIGGIDNR
GSHFYLALYWAQELAQQTEDATLAAAFAPLAEKLAGAEATIVDELLSVQGDPADVGGYYR
PDAALAAAVMRPSATLNAAIDAL
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgagccccaggccgctgccggcaagatcatctacacgttcaccgacgaggcg
ccgctgctggcgaccttctcgttcctcccgatcgtccaggcatacgcggcgcaggccgga
gtcgacgtcgacacgcgggacatctcgctggccgggcgcatcctggcccagttccccgag
tcgctcaccgccgagcagcgcgtcgacgacgccctcgccgagctcggccggatggccacc
acgcccgaggccaacatcatcaagctgccgaacatctcggcgtcggtgccgcagctcaag
gccgccgtcgccgagctgcagtcgcagggcttcgccatccccgactaccccgagaacccg
tcgaccgacgccgagcgcgaggcacgcgccaagtacgacaaggtcaagggctccgccgtc
aacccggtgctgcgcgagggcaactccgaccgccgcgcccccggcgccgtgaagaactac
gccaaggcgcacccgcaccgcatgggcgcctggtcggcggactccaagaccgccgtcgcc
acgatgggcgagcacgacttcttcgccaacgagaagtccgtgacggtccccgccgccgac
accctgacgatccggctgcgcaccgccgacggcaccaccgtgctcaaggacggcctgcag
gtcgaggccggcgaggtcgtcgacgccaccttcatgtcggtcgccgcgctgcgcaccttc
ctcgccgagcaggtggagcgcgcccgcgccgagggcgtcctgttctccgcccacctcaag
gccacgatgatgaaggtctccgacccgatcgtcttcggccacgtcgtcgagaccttcctg
ccccaggtgttcgagcgctacggcgccgacctcgaggcagccggcctgtccgcgcgcgac
ggcctcggcggcatcctcgccggcctggacgcgctcgacaacggcgccgagatccgcgcc
gccatcgagcagggcctcgccgacggtcccgcgctggccatggtcgactcggacaagggc
atcaccaacctgcacgtcccctccgacgtcatcatcgacgcctccatgcccgccatgatc
cgcatcggcgggcacatgtggggtcccgacggcgccgagcacgacaccctggctgtcatc
cccgactcgtcctacgccggcgtctaccaggccgtcatcgacgactgcaaggccaagggc
gccctcgaccccgccaccatgggctccgtgccgaacgtcggcctcatggcgaggaaggcc
gaggagtacggctcgcacgacaagacgttcgagatcccgaccgacggcaccgtcgaggtc
gtgaacgcggcgggcgaggtgctgatctcccacgacgtcgccgccggtgacgtgtggcgc
gcctgccagaccaaggacgccccgatccgcgactgggtcggcctcgccgtccgccgcgcc
cgcgagtccggcaccccggccgtgttctggctggacgccgaccgcgcccacgacgcgcag
ctcctgctcaagctcgagcagtacctcccggagcacgacaccgagggcctcgagatcctc
gtcatgaacccggccgaggccacccgctactcgctggaccgcatccgcgagggcctcgac
accatctccgtcaccggcaacgtgctgcgcgactacaacaccgacctgttcccgatcctc
gaggtcggcacgtcggcgaagatgctgtccatcgtcccgctgatgaacggcggcggcctg
ttcgagacgggtgccggcggctccgccccgaagcacgtccagcagctcctcgcggagaac
tacctgcgctgggactcgctcggcgagttcttcgcgctggcggcctcgttcgagcacctc
gcccgcgtcgagggcaacgccggggcgaaggtcctcgccgacaccctcgaccgcgccacg
gagaccttcctcaacgaggaccggtcgcccacccgtcgcatcggcggcatcgacaaccgc
ggctcgcacttctacctggcgctctactgggcccaggagctcgcgcagcagacggaggac
gccacgctggccgcggcgttcgcgccgctcgccgagaagctggccggcgccgaggccacc
atcgtcgacgagctcctctccgtccagggcgacccggccgacgtcggcggctactaccgc
cccgacgcggcgctcgctgccgccgtgatgcgcccgtccgcgacgctcaacgccgcgatc
gacgcactctga

DBGET integrated database retrieval system