KEGG   Isoptericola dokdonensis: I598_2771Help
Entry
I598_2771         CDS       T04384                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
ido  Isoptericola dokdonensis
Brite
KEGG Orthology (KO) [BR:ido00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    I598_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ANC32296
UniProt: A0A168FQE1
LinkDB All DBs
Position
complement(2982565..2983689)
Genome map
AA seq 374 aa AA seqDB search
MADTEEPREKAVAQDGVPVEAVAPQDPVTDGTDRARPAYGQAFKSSLREFSEDGCTDLAA
ALTYYAVMASAPALLALVSLLGFVGDAEAALDSITATLEEFLPQETLDIVEPLISNALTS
TGAGLALVVGLALALWSASGYVGAFGRAMNVVYEVAEGRPVWKLRPVMYGITLVVVLLAV
VIVASLVLSGPIVTAIGDTVGLSDVALTVWGIAKWPVALLLVVFVVALLYHFTPNVRHPR
FRWISVGAAVAIGVWILASAGFAFYVTSFGSYGSTYGTLGTVIVFLLWLWITNLALLFGA
ELDSEIERSRELRDGYPAEVTLQLPPRDTKASDKKAAKRREAVAEARALRESAARDRSTD
TGEGRPEPGTAPDA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaccgaggaaccccgcgagaaggcagtggcgcaggacggcgtccccgtggag
gcggtcgcgccccaggaccccgtcaccgacggcacggaccgggcccgccccgcctacggc
caggcgttcaagagctccctgcgggagttctccgaggacggctgcaccgacctcgccgcc
gcgctgacctactacgcggtgatggcgtccgcgcccgcgctgctggccctggtgtcactc
ctgggtttcgtcggggacgccgaggcggccctcgactcgatcacggcgacgctcgaggag
ttcctcccccaggagaccctggacatcgtggagccgctgatctccaacgccctgacctcc
accggcgccggcctcgcgctcgtcgtcggcctggcgctcgccctgtggtccgcgtcgggg
tacgtcggcgcgttcggccgggcgatgaacgtcgtctacgaggtcgccgaggggcggccc
gtgtggaagctccgccccgtcatgtatgggatcacgctcgtggtggtgctgctcgccgtc
gtcatcgtcgcgagcctcgtgctgtccgggccgatcgtcaccgcgatcggcgacaccgtc
gggctctccgacgtcgccctcaccgtgtggggcatcgcgaagtggcccgtggcgctgctg
ctcgtcgtgttcgtcgtcgccctgctctaccacttcaccccgaacgtcaggcacccacgg
ttccggtggatcagcgtgggcgccgccgtcgccatcggcgtgtggatcctcgcctcggcc
ggcttcgcgttctacgtgacgagcttcggcagctacgggtccacctacggcaccctgggc
accgtcatcgtgttcctgctgtggctgtggatcaccaacctcgcgctgctcttcggggcc
gagctcgactccgagatcgagcgcagccgcgagctgcgcgacggctacccggccgaggtg
acgctccagctcccgccgcgggacacgaaggcgagcgacaagaaggcggcgaagcgccgc
gaggcggtcgccgaggcccgcgcgctgcgcgagtccgcggcccgcgaccggtccacggac
accggcgagggccgccccgagcccgggacggcccccgacgcctga

DBGET integrated database retrieval system