KEGG   Isoptericola dokdonensis: I598_3257Help
Entry
I598_3257         CDS       T04384                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ido  Isoptericola dokdonensis
Pathway
ido03030  DNA replication
ido03410  Base excision repair
ido03420  Nucleotide excision repair
ido03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ido00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    I598_3257
   03410 Base excision repair
    I598_3257
   03420 Nucleotide excision repair
    I598_3257
   03430 Mismatch repair
    I598_3257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ido03032]
    I598_3257
   03400 DNA repair and recombination proteins [BR:ido03400]
    I598_3257
Enzymes [BR:ido01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     I598_3257
    6.5.1.6  DNA ligase (ATP or NAD+)
     I598_3257
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     I598_3257
DNA replication proteins [BR:ido03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    I598_3257
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     I598_3257
DNA repair and recombination proteins [BR:ido03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     I598_3257
   NER (nucleotide excision repair)
    Other NER factors
     I598_3257
   MMR (mismatch exicision repair)
    Other MMR factors
     I598_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase NPV_P10
Motif
Other DBs
NCBI-ProteinID: ANC32766
UniProt: A0A168FZ13
LinkDB All DBs
Position
complement(3532039..3533571)
Genome map
AA seq 510 aa AA seqDB search
MLLAELVRTHAAVAATRSRLTKRAELAAALRAAGEVGDGDEVEIVASYLSGRLRQRRTGV
GWRSLADLPPAATDPVLTPRDVDDALEAVSALSGPGSATARATAVADLFGLATTDEQRFL
RGLVLGELRQGALDSLLLDAVADAAGVPVALVRRAAMFSADSGPIARAALTGGAAALEAF
GLEVGRPVRPMLASSAPDVAAAVEKLGGGQVVADVKLDGIRVQVHKRDDDVRVLTRSLDD
ITERLPEIVELTRSLDVGAAVLDGEALALDEAGRPRPFQETASRAGTHDVAEVAATVPLT
VRFFDVLHADGVDLIDAPTRERLDVLDRVVPPDARVPRLVTDDVDAVTRFFTGAVADGYE
GLVVKDLAAGYAAGRRGAAWVKVKPRHTLDLVVLAVERGSGRREGTLSNIHLGARDGDGF
VLLGKTFKGMTDEMLAWQTQRFRELETADDGWVVSVRPEQVVEIAFDGVQRSTRYPGGVA
LRFARVLRYRDDKPAAEADTLDAVRSHLSP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctcgccgagctcgtccgcacccatgccgccgtcgccgcgacgcgctcccggctg
accaagcgggccgagctcgccgctgcgctgcgcgccgccggtgaggtgggcgacggcgac
gaggtggagatcgtcgcgtcgtacctgtccgggcggctgcgccagcgccgtaccggcgtg
ggctggcggtcgctggcggacctcccgcccgcggcgaccgaccccgtcctcacacctcgc
gacgtcgacgacgccctggaggcggtgtccgcgctgtccgggccgggttccgcgacggcc
cgggccaccgcggtggcggacctgttcgggctggcgaccaccgacgagcagcggttcctg
cgcgggctggtcctgggtgagctgcgtcagggcgccctggactccctgctgctcgacgcc
gtcgcggacgccgcgggcgtgccggtcgccctggtgcgccgggcggcgatgttcagcgcc
gactccggaccgatcgcgcgggccgccctcaccggcggggccgcggccctggaggcgttc
ggcctggaggtcgggcgaccggtgcggccgatgctcgcgtcgtcggcgccggacgtcgcg
gcggccgtggagaagctgggcggcgggcaggtcgtggcggacgtcaagctcgacggcatc
cgcgtccaggtgcacaagcgcgacgacgacgtccgggtcctgacgcggtccctggacgac
atcaccgagcggctgcccgagatcgtggagctcacccggtccctcgacgtcggtgccgcg
gtgctcgacggcgaggccctcgcgctggacgaggccggacggccgcgcccgttccaggag
acggcgtctcgggcgggcacccacgatgtcgctgaggtggcggccaccgtgccgctgacc
gtccggttcttcgacgtgctgcacgccgacggcgtcgacctcatcgacgcgcccacccgc
gagcgtctcgacgtcctggaccgggtcgtgccgcccgacgcgcgcgtgcctcggctggtc
accgacgacgtggacgcggtgacgcggttcttcaccggcgccgtcgcggacggctacgag
gggctggtcgtcaaggacctggccgccgggtacgcggcgggccgccgcggcgccgcctgg
gtgaaggtgaagccgcggcacaccctcgacctcgtggtgctcgccgtcgagcggggctcg
gggcgtcgcgagggcacgctgtcgaacatccacctcggggctcgcgacggcgacgggttc
gtgctgctcggcaagacgttcaaggggatgaccgacgagatgctcgcctggcagacgcag
cggttccgcgagctggagaccgccgacgacggctgggtcgtgagcgtccgccccgagcag
gtcgtcgagatcgcgttcgacggcgtgcagcgctccacccgctacccgggcggcgtcgcc
ctgcggttcgcccgcgtgctgcgctaccgcgacgacaagcccgccgccgaggcggacacc
ctcgacgccgtgcgctcgcacctgtcgccgtag

DBGET integrated database retrieval system