KEGG   Idiomarina sp. OT37-5b: C5610_01015Help
Entry
C5610_01015       CDS       T05379                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
idt  Idiomarina sp. OT37-5b
Pathway
idt00260  Glycine, serine and threonine metabolism
idt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:idt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C5610_01015
Enzymes [BR:idt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     C5610_01015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 FAD_binding_2 AlaDh_PNT_C Pyr_redox_2 HI0933_like ADH_zinc_N_2 Pyr_redox_3 Pyr_redox FAD_oxidored Methyltransf_25 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AVJ57246
UniProt: A0A2S0IPJ6
LinkDB All DBs
Position
complement(207177..208202)
Genome map
AA seq 341 aa AA seqDB search
MKALAKLHDKPGIWMTDVDKPEYGYNDILIKIKKTAICGTDVHIYKWDEWSQKTIPVPMV
VGHEYVGEVAAMGEGVRGFEIGDRVSGEGHITCGHCRNCRAGRRHLCRNTYGVGVNRPGA
FAEYLVIPADNAFKLPDDVSDDMAAIMDPFGNAVHTALAFDLVGEDVLITGAGPIGIMAA
AVARHVGARHVVITDVNEFRLDLARKMGVTRAVNVAEQKLTDVMDELGMKEGFDVGLEMS
GVPSAFSQMLATMNHGGKIAMLGIPPENVAIDWNQVIFKGLVIKGIYGREMFETWYKMAS
LLQSGLDISPILTHQMHVDDYEQGFETMISGHSGKVILNWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttagcgaagctgcacgataaacccggcatctggatgaccgacgttgataaa
ccggaatacggttacaacgacatcctgattaaaattaagaaaaccgcgatttgcggtacc
gacgtgcacatctataagtgggatgagtggtcacagaagaccattccggtgccgatggtc
gttggccacgaatacgttggcgaagtagcagccatgggtgaaggcgtgcgtggttttgaa
attggcgaccgcgtctccggtgaaggtcatattacctgcggccattgccgtaactgccgt
gccggccgccgccacttatgtcgcaatacctacggcgtaggtgtaaatcgtcccggcgca
tttgctgagtacctggtgattccggctgataatgcctttaaactgcctgacgatgtcagc
gatgacatggccgccatcatggaccccttcgggaacgccgtgcacactgcgttggcgttt
gacctggtgggtgaggacgtgctgattaccggtgctggtcctatcggtatcatggcggca
gctgtcgctcgtcacgttggcgcacgccatgtcgtcatcaccgacgttaatgagtttcgt
ctggaccttgcccgtaaaatgggcgttacccgagcggttaatgtggctgagcaaaagctc
accgacgtgatggacgaactgggcatgaaagaaggtttcgatgtcgggctggaaatgtca
ggggtaccgtcggcgttttcacaaatgttggcgaccatgaaccacggcggcaaaattgcc
atgttgggtataccgccggagaatgtcgccattgactggaaccaggttatttttaaaggc
ttggtgatcaaaggcatttacggacgcgaaatgtttgagacctggtataaaatggcgagc
ctgctacagtcaggtttagatatttcaccgattttgacacaccagatgcacgtcgatgac
tatgaacaaggcttcgaaaccatgatcagcgggcattccggcaaagtgattttaaactgg
gattaa

DBGET integrated database retrieval system