KEGG   Idiomarina sp. OT37-5b: C5610_11405Help
Entry
C5610_11405       CDS       T05379                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
idt  Idiomarina sp. OT37-5b
Pathway
idt00500  Starch and sucrose metabolism
idt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:idt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C5610_11405
Enzymes [BR:idt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     C5610_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 TPR_6
Motif
Other DBs
NCBI-ProteinID: AVJ56834
UniProt: A0A2S0IMR7
LinkDB All DBs
Position
complement(2414126..2416513)
Genome map
AA seq 795 aa AA seqDB search
MKVVNAIASAMLLAGLAGCNSGTTEAASQVAPGAPGETPFWAYSGKTGIGTSYEAYQQGH
YDDASATGTVSKVWFSLAKGMITETMFGLIHQAQIRDLQFIVSGDDFVVAESDGLKNTVE
YLHVDEQGRPLSLAYRVTSEDSQGRFRIIKDIFTDPDAQSLMVRVRFEANQPGLTAHVQV
NPYVNNDGVDDRAKVEGDALVAYSGEHYLTLQSEQGLKQGSVGFMGTSDRYSQLQTSGEL
TRYQSTGEQPGNVSMSATLGEISEAAEFDLVLSYGNSEQQAREQGQQTLKRGYDTVLAHY
NGEGDAIGWQDYLQSLNLEEMYGATTDGGKLLNTSALVLKAQEDKTYAGALIASLSNPWG
DTVSAEQGKTGYKAVWVRDFYQVAMAFLALGDTETAKAAFSYLPKVQVREDTPGNQGDTG
WFLQKTHVDGELEWVAVQLDQTSMPIMLAWKLYKNGVLSETELSQWYESMLKPAADFLVD
GGLAKILWNDTQITPPYTQQERWEEQAGYSPSTIAATVTGLITASEIAALSGDQENAQRY
LETAREYEQDIEALMFTTEGTLEGDAADGQYFVRIAQDENVNADTKLAANNGRPGMDKKL
ILDGGFLELVRYGVRSADSPSIVASLPEYDDQSLEHKLRVKYTFMNDQGQSFPGWRRYGN
DGYGEDQELGTNYAEGGNQTAGQRGRVWPFFTGERGHYEIAVAKASDGDLTDAQYQRIKN
TYVLGMEAFANQGMMLPEQVWDGVGVNPFGYEVGEGTNSATPLAWTHAEYVKLLRSLSDE
AVWDNYPLVEQKLAD
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtcgtaaacgcaatcgccagtgcaatgttactggcaggactagcaggctgtaac
agcggcactaccgaagccgccagtcaggtggcgccgggcgcaccgggggaaacaccgttt
tgggcctactcgggtaaaaccggcatcggcacttcttatgaagcgtatcaacaggggcac
tatgacgacgccagtgccaccggcacggtttccaaggtctggttctcgttggctaaaggg
atgatcacggaaaccatgtttggccttattcaccaagcgcaaatccgtgatttacagttt
atcgtcagcggcgatgattttgtggtggcagagtcagatgggctgaaaaataccgtggaa
tacctgcatgtggatgagcagggccggccgctgtcgttggcgtatcgcgtgaccagtgag
gatagccagggacgttttcgcatcatcaaagacatctttaccgatcctgatgcgcaatcg
ctgatggttcgtgtgcgctttgaagctaatcaacccgggctcaccgctcacgtacaggtg
aacccttatgtgaacaacgatggcgtcgatgaccgtgctaaggtcgagggtgatgcgtta
gtggcctactccggcgaacattacctgacgttacaaagtgaacaaggtttaaaacaaggt
tcggtaggctttatgggcacatccgaccgctattctcaattacaaacctcaggcgaactg
acgcgctatcagagcaccggtgagcaacccggtaatgtgtctatgagtgcgaccctgggt
gagatctcagaagcggccgaatttgatttggtactgagttacggtaacagcgaacaacag
gccagagagcaggggcaacagaccttgaagcgcggatacgataccgtgctggcgcattac
aacggtgagggtgacgcgattggctggcaagattatctgcaaagcttgaaccttgaagaa
atgtacggcgccactacggatggtggcaagttactgaataccagtgccctggtgctcaaa
gctcaggaagacaaaacctatgctggcgcgttgattgcgtcgttatcaaacccttggggc
gatacggtttctgccgaacagggtaaaacgggctataaagcggtttgggtgcgcgacttt
tatcaagtagcgatggcgtttctggcgctgggcgacaccgaaacggctaaagccgcgttc
agttacttgccgaaggtacaagtcagagaggatacgccgggaaatcagggggataccggt
tggttcctgcaaaaaacccacgttgacggcgaattggaatgggtggcagtacagcttgat
caaacctcgatgccgatcatgctggcctggaaactctataaaaacggcgtgctgtcagaa
actgagctgagccagtggtacgaatcaatgcttaagcctgcggccgattttctggttgac
ggaggtttagcgaaaatattgtggaatgatactcagatcacgccgccttatacccagcag
gagcgttgggaagaacaggcaggatactctccttcaaccattgccgccacggtaactggc
ctgataaccgccagcgagatcgccgctctgagcggtgaccaggaaaacgcacaacgctat
ctggaaaccgcgcgggagtatgaacaggatatcgaagctttgatgttcacaacggagggc
acgctggagggcgatgcagctgacggtcaatattttgtgcgcatcgcacaggatgaaaac
gtcaatgcagacaccaaactggcagccaataatggtcgtccggggatggataaaaaactg
atccttgatggtggctttttagagctggtgcgttacggcgtgcgttctgctgatagtccg
tcgattgtggcgtcgttaccggaatatgacgatcaaagcctcgagcataagctacgggtt
aaatacacctttatgaacgatcaagggcaaagcttccctggctggcgccgttatggcaat
gatggctacggcgaggatcaggagctaggcaccaattatgctgaaggcggcaaccagacg
gcaggtcaacgtggccgcgtctggcctttctttaccggtgagcgggggcattatgaaatc
gccgttgcgaaagccagtgacggcgacctgacggacgcgcagtaccaacggattaaaaac
acctatgtgttgggaatggaagcatttgcgaaccaaggcatgatgttaccggaacaggta
tgggacggcgtcggggtcaatcctttcggttatgaggttggcgaaggcaccaactcagcc
acaccattggcgtggactcatgccgaatacgttaagctgttacgctcgctgagtgacgaa
gcggtatgggataattatccgcttgtggaacagaagctcgctgactga

DBGET integrated database retrieval system