KEGG   Idiomarina sp. OT37-5b: C5610_11765Help
Entry
C5610_11765       CDS       T05379                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
idt  Idiomarina sp. OT37-5b
Pathway
idt00250  Alanine, aspartate and glutamate metabolism
idt00410  beta-Alanine metabolism
idt00430  Taurine and hypotaurine metabolism
idt00650  Butanoate metabolism
idt01100  Metabolic pathways
idt01110  Biosynthesis of secondary metabolites
idt01120  Microbial metabolism in diverse environments
idt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:idt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C5610_11765 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C5610_11765 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C5610_11765 (panP)
   00430 Taurine and hypotaurine metabolism
    C5610_11765 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C5610_11765 (panP)
Enzymes [BR:idt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C5610_11765 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HTH_8
Motif
Other DBs
NCBI-ProteinID: AVJ57407
UniProt: A0A2S0IPI7
LinkDB All DBs
Position
complement(2500353..2501993)
Genome map
AA seq 546 aa AA seqDB search
MAEVNQEALYRIFTIPEAPDSTLGKIEKHLSENLMGFLGEHIVAREKPLQEIERDFEQAN
IPEDPQFVSEHTEFLLNKLVAHSVHTASPKFIGHMTSALPYFLLPLAKLMVGLNQNLVKI
ETSKAFTPLERNVIGMLHHLVYQQDAGFYNRWMHSAQHSLGAFCSGGTVANMTALWVARN
RLLKPDGDFAGIAAEGLAAGLAHYGYKKLVVLVSERGHYSLAKAADVLGIGRRNLVSVAT
DENNRIKVDALRQACEKVQQEGGRVLAIIGVAGTTETGHIDPLAEMADIARDYDTHFHVD
AAWGGATLLSNQHRGLLNGIEQADSVTIDAHKQMYVPMGAGMVLFKNPSLVKAIEHHAEY
IIRQGSKDLGSHSMEGSRAGMAMMVFSAMHVIGRRGYELLINNSIEKARYFADLIRAQDD
FEVITEPELCLLTYRFVPKKVKQALAGANQEQVERLTPHLNALTRYVQKRQRESGRSFVS
RTKLTPAQYYHEPSVVFRVVLANPLTTEAMLQEIIQEQREIAEKATSLRGALHTEMRELG
MIVSDH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
attgctgaggtcaatcaggaagctttgtatcgtatttttacgataccggaggcacctgac
tcgaccttaggaaaaattgaaaaacatttgtcggaaaacttgatgggttttctgggtgaa
catattgttgcgcgggaaaagcctctgcaggaaattgagcgtgactttgaacaggccaac
attcctgaagatcctcagtttgtttctgagcataccgagtttctgctgaataagttggtc
gcgcattcggtgcatacggcgtcgcctaaatttatcggccatatgacctcagcgttgccg
tattttttgttgccactggccaagctgatggttggtctaaaccaaaatctggtgaagatt
gaaacatcaaaagcgtttacgccgctggagcgcaacgttattggtatgcttcatcatttg
gtctatcaacaggacgccggtttttacaaccgctggatgcacagtgcacaacattcactg
ggcgcattctgctcgggtggaaccgttgccaacatgaccgcgctatgggttgcacgcaac
cgtctgttaaagccggatggtgattttgccgggatcgcggcagaagggctggcggcaggg
ttagcgcactatggttataaaaaactggtggtattggtctctgaacgaggtcattactcg
ttggcaaaagccgcggatgtgctcggtatcggtcgacgtaacctggtgtctgttgctacc
gacgagaacaacagaattaaggtggatgcgttacgtcaggcctgtgaaaaagtccagcag
gaaggtggtcgtgtgttagccatcattggtgtggcaggtactaccgagaccggccatatt
gatccactggcagagatggctgacattgcccgtgactatgacactcactttcatgtcgat
gcggcctggggtggggctaccttgttgtcgaatcaacatcgcggtttactgaacggcatt
gaacaagccgatagcgttaccattgatgcgcataagcagatgtacgtgccgatgggcgcg
ggtatggtgttatttaaaaacccttcgctggttaaagcgattgagcaccatgccgagtat
attattcgtcagggctctaaagatttggggtcacactcgatggaaggctcacgagccggg
atggcaatgatggtgttctcggcgatgcacgtgattggccgtcgaggttatgaattattg
atcaataatagtatcgaaaaagcccgttacttcgccgatctgattcgggcgcaggatgat
ttcgaagtgattacggaacctgagctgtgcctgttaacttaccgttttgttccgaaaaaa
gttaaacaagcattggctggcgctaatcaggagcaagtcgagcgactaacgccacacctt
aatgccttgacacgttacgtgcaaaaacggcagcgtgaaagcggtcgctcctttgtttcc
cgaaccaaactgacgccggcacaatattatcacgagccaagtgtcgtattccgggttgta
ttagcgaacccgttgaccaccgaggcgatgttgcaggaaattattcaggaacaacgtgag
atcgcagagaaagcgaccagcctacggggagccttgcacacggaaatgcgtgaactaggc
atgatcgttagcgatcactag

DBGET integrated database retrieval system