KEGG   Idiomarina sp. OT37-5b: C5610_12380Help
Entry
C5610_12380       CDS       T05379                                 

Definition
(GenBank) hypothetical protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
idt  Idiomarina sp. OT37-5b
Brite
KEGG Orthology (KO) [BR:idt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:idt03400]
    C5610_12380
DNA repair and recombination proteins [BR:idt03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     C5610_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 AAA_21 SMC_N
Motif
Other DBs
NCBI-ProteinID: AVJ57007
UniProt: A0A2S0INE3
LinkDB All DBs
Position
2629919..2632987
Genome map
AA seq 1022 aa AA seqDB search
MKPILLAMQAFGPFAEREVIDFRALGEHPLFLINGATGAGKTTILDAISYALFGKTTGAE
RQGEQMRCHHAAVDVATEVDFIFAIGTNIYRVQRLPTQWRPKLRGEGLKEDRATATLWQI
TAGTEPTFDLNTDQQKLLASRKVNDVTQHVEQLIGLKADQFRQVVVLPQGKFRELLTADA
GQREDIFAQLFQTHRYLLIEEQLKESARELRQQMRQHEQNLQALLDDAKVTSEQELTERL
QQLRPQLSQLEQQKTSQAKAVQQLRSQLLQAQHVQKQFAQQQQLLSERDQLRNREPQINT
QQQRLERAKKAQQLAADSQHLALLQQQSQELRSRTEQLQTQQQQLSESKQQVEQAYQRAL
QLDDDNQTLRRQLEQQRQWLPKLESLQQMATEQQQLAAKLTQDQRQLTEIDGELQQQREN
NIHAQQQLDELRTALDQQTSLEAEQHQLTLWQQQRQRHEELERQQQQLRQQQQQLQQQLL
AQRATTHAAEQQSQHLENRWYDQQALTLARTLESGKPCPVCGATEHPSPAHNQDEELVEH
QQVIAARKTFQQEQQKQQQLEQQLSHSQNRLDLVQQQLHENGEPKAPQQLDQLRQQLAAK
TSHYQQQRRQLVRLNQQISEGQQRLEQLGTKQRTLAERIHQQQLQKQTADERLRMLRQEI
PEDLRSAEQLQQSMSALEHQLQQNLSRQRRATEQREQLLEQLSAVASQLDSTGQQAKNVQ
QQHQHVEQKFQKQLQELGFASNNDYESARLSSGEYQQLEQQIAEFKQQVTRVDSLLFELQ
QALDGKQAPDIDALQQQQQAAESERQRSEQDWLALRDQCIQLENVLKRVNNSKKQAEQLH
KRYAVQGTLADVASGQNTQRLSLHRFVLSVLLDDVLNVASERLQQMTHGRYQLLREQTVA
DARSAGGLTLLVEDAYTGQQRSTKTLSGGEGFMAALALALGLSDVVQSYAGGIRLDTLFV
DEGFGSLDDEALDMAINTLAELRASGRTIGIISHVRELKDRLQDRIDVIRERSGSRIVMR
TQ
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctatattgctcgccatgcaggcgtttgggccgttcgccgaacgtgaagttatc
gatttcagagcactcggagaacatcctctttttctgatcaatggcgcaacgggagccggt
aaaacgaccattttggatgccatcagttatgcgttattcggaaagaccactggcgcagaa
cgacaaggcgaacaaatgcgctgtcaccacgcggccgttgatgtagcaaccgaagtggat
tttatttttgcgataggcacaaacatctaccgtgtccagcgtttaccaactcaatggcga
ccaaaacttcgcggtgagggcttaaaggaagaccgagcgacagccacactctggcaaatc
actgcgggtacggagccgactttcgatctcaatacggatcaacaaaaactgctggcaagc
cgcaaagttaatgacgttactcagcacgttgagcaacttattggcttaaaggctgaccaa
ttccgacaggtggtggtgttaccccagggcaaatttcgtgaactcttaacggccgatgcc
ggccaacgcgaagacatttttgcacagctgttccaaacacatcgctacttattgattgaa
gaacagttaaaagagtctgctcgtgaactgcgccagcagatgcgtcagcacgaacaaaac
ttacaagccctgctggatgatgcaaaagtcaccagcgaacaggagctgaccgagcgatta
caacaattgcgcccgcagctaagccaactagagcaacagaagacgtcgcaggcaaaagcg
gtgcagcaactgcgctcgcaattgttgcaggctcaacacgtgcaaaagcagtttgcacaa
caacaacagttgctgagcgagcgcgatcaattgcgcaacagagaaccgcaaataaacacc
caacagcagcgccttgaacgtgccaaaaaagcacaacagttggcagccgacagccaacat
ttggcattgttacagcagcaatcgcaagagctgcgcagtcgtaccgagcagttgcaaaca
cagcaacaacagctcagtgagagtaaacaacaggtggaacaggcctatcagcgggcactt
cagctcgacgatgataaccaaacactgcgccgccagcttgaacaacaacggcaatggtta
cccaaactcgaatcgttgcagcagatggccacagagcaacagcaattggcggccaagtta
acgcaagatcaacggcaattgactgaaatcgatggcgaacttcagcaacagcgcgaaaac
aacatccatgctcaacagcaattggatgagcttcgtactgcactggatcaacaaacatca
ttggaagccgaacagcatcagctaacactgtggcagcagcaacgccagcggcatgaagaa
ctcgaacgccagcaacagcaactgcgccaacagcaacaacaactgcagcaacaactgctg
gctcaacgcgcaaccacccacgccgcggagcaacagagccagcatctggaaaaccgatgg
tacgatcaacaagctctgacactggctcgaacacttgagtccggtaagccgtgcccggtg
tgtggtgccaccgaacaccccagcccggcgcacaatcaggatgaggaattagtagaacac
cagcaagtcatcgctgcacgtaaaacgtttcaacaggaacaacaaaagcaacagcaactg
gaacagcagttgagtcacagccaaaaccggttggatctggtgcaacagcagttgcatgaa
aatggtgagcctaaagcgccacaacaactggaccagctgcgccagcaactggccgccaaa
acgagtcattatcaacagcagcgccggcagttggtaagactgaatcaacaaatttcggag
ggccaacagcgattagaacagctgggtacgaaacagcggacattagccgaacgtattcat
cagcagcagttgcaaaagcagacggccgatgaacgtttgcgcatgttgcgccaagagatt
ccggaagatctgcgttcggcagaacagttacaacaatcaatgagcgctttggagcatcag
ttacaacaaaacttaagccgtcagcgccgcgccaccgaacagcgcgaacaactgctcgag
cagctctccgccgtcgcttctcagctcgatagcaccggccaacaagccaaaaatgtgcag
cagcaacaccaacacgttgaacaaaagttccagaaacagttgcaagagctgggttttgcc
agtaacaatgactatgaaagtgcccgcctgagcagcggcgagtaccagcaactcgaacaa
cagatcgctgagtttaaacagcaagttactcgcgtcgacagtttgttatttgaactgcaa
caagcgctggatggtaagcaagcgcccgatattgatgcgttacagcagcaacaacaagcc
gctgaatccgagcgacaacgatccgaacaagattggcttgctctccgcgatcagtgcatc
cagctggaaaacgttttaaaacgtgttaataacagtaaaaagcaagcagaacaattacat
aagcgctatgctgtgcaaggaactttggctgatgtcgccagcggacaaaacacacaacgg
cttagccttcaccgcttcgtgctgagcgtcttgcttgatgatgtattaaacgtagcttcc
gagcgcctgcagcagatgactcatggccgctatcagctattacgcgaacagaccgttgcc
gatgcccgttcagccggcggcttaaccctattggtcgaagatgcctataccggccagcaa
cgcagtacaaaaacgctgtctggtggcgagggctttatggccgcattagcacttgctttg
ggtctttcagatgtcgtacagagttatgccggtggcatcaggttagatactttgtttgtt
gatgaaggctttggtagcctcgatgatgaggcgctcgatatggccattaataccctggca
gaattacgtgccagtggtcggactattggaattatctcgcatgtgcgagaattaaaagat
cgcctgcaagaccgtattgatgtcatccgtgaacgcagtggcagcaggatagtaatgagg
actcagtaa

DBGET integrated database retrieval system