KEGG   Idiomarina loihiensis GSL 199: K734_00230Help
Entry
K734_00230        CDS       T02681                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ili00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    K734_00230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ili02000]
    K734_00230
Enzymes [BR:ili01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     K734_00230
Transporters [BR:ili02000]
 Other Transporters
  Pores ion channels [TC:1]
   K734_00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AGM34913
LinkDB All DBs
Position
complement(50131..50769)
Genome map
AA seq 212 aa AA seqDB search
MKENMSKNTKEIVFYTNPESRARIVRRMLEEVGQPYTVKVLNYNGEMKTPEYLKVNPLGK
VPAIQHGDLVVTETAAICAYLADQFPEKNLAPPLDSPERGTYYRWLFFAAGPVEMANSAK
ACGWNLEDNLQMVGSGSHDDVLKALELAVSKGPYICGEQFTAADVYVGSHISWGMQFKTL
EERDSFKRYVERIEKRPAFQRATKLDDELSKG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaatatgtctaaaaacaccaaagaaatcgttttctatactaaccctgagtcc
cgggcacgcattgttcgtcgtatgctggaagaggttggccagccgtatacggtcaaagta
cttaactacaatggcgagatgaaaacgcccgagtatctgaaagttaatccgttaggaaag
gtgccggcaatacaacacggcgatttggttgttacggaaaccgccgccatttgtgcctac
ctggccgatcagtttccggaaaagaacttagctccaccactggacagcccggagcgagga
acttactaccgttggctattctttgcggccggtccggtggaaatggccaacagcgccaaa
gcctgtggctggaaccttgaagataacctgcaaatggttggctctggtagtcacgacgat
gtcctgaaagctcttgaattagccgtttctaaaggaccttatatttgtggcgagcagttt
accgcggcagatgtatacgttggtagtcatattagctggggcatgcagttcaaaacactg
gaggagcgcgactcattcaaacgttatgttgaacgaattgagaagcgccccgctttccag
cgggcaacgaaactcgatgacgaattgagtaaaggctag

DBGET integrated database retrieval system