KEGG   Idiomarina loihiensis GSL 199: K734_02195Help
Entry
K734_02195        CDS       T02681                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili00473  D-Alanine metabolism
ili00550  Peptidoglycan biosynthesis
ili01100  Metabolic pathways
ili01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ili00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    K734_02195
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K734_02195
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    K734_02195
Enzymes [BR:ili01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     K734_02195
Peptidoglycan biosynthesis and degradation proteins [BR:ili01011]
 Precursor biosynthesis
  Amino acid ligase
   K734_02195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATPgrasp_Ter ATP-grasp ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AGM35306
LinkDB All DBs
Position
454040..454969
Genome map
AA seq 309 aa AA seqDB search
MKANAFGKVAVMLGGTSAERDVSLKSGMAVLKGLVAKGIDAHAFDPAAHSLQELVEQKFD
RVFIALHGRGGEDGSMQGALQILEMPYTGSDVLGCALGMDKVRCKQIWHSVGLPTANWRV
VTQAEIEQVNVEAMLQELGGRVIVKPAREGSSIGMSIADNGRSLALALQHAAEFDDDLLV
EQWVEGAEYTIGILEGKALPVIRLQTPHEFYDFEAKYQANDTQYHCPAGLSDDDEASLRT
LAERAFAAIGGSGWGRIDVMRNNAGEWFLLEANTVPGMTEKSLVPMAAKVAGLQFNDLVE
RILAQTLER
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctaatgcctttggtaaagtggccgtcatgctgggcggtacgtcggctgagcgc
gatgtttcgctgaaatccggaatggcggtattaaaaggcttggttgcgaaaggcatcgat
gcacacgcatttgacccggcggcgcatagcttgcaggagcttgtggagcaaaagtttgat
cgcgtatttatcgctttgcatggccgcggcggtgaagatggcagcatgcagggggcgttg
caaatactggaaatgccatacaccggcagtgatgttctgggctgtgcgctgggtatggat
aaagtgcgttgtaaacaaatttggcattcagtgggtctgccaaccgccaattggcgggtg
gtaacgcaagctgaaatagagcaagtgaacgtggaagctatgttgcaggagctcggtggc
cgggtgattgtaaaaccagcacgtgaaggctcctctataggtatgagcattgccgataac
gggcgaagcctggctttagccttgcagcatgcggctgagtttgacgacgaccttttggtc
gaacagtgggttgaaggtgcggaatataccattggcatactggaaggtaaggcattaccg
gttattcgactgcaaacgccacatgagttttatgattttgaagctaagtatcaggcaaat
gatacccagtatcactgccctgcagggctaagtgacgatgacgaagcaagtttgcgaacc
ttggctgaacgcgctttcgcggccataggaggtagtggctggggacgcatcgatgtgatg
cgcaataacgcgggtgagtggtttttgttagaggccaatacggtaccgggaatgacagaa
aaaagcctggtacctatggcggcaaaagttgctggtttacagtttaatgacttagtggag
cgcattttagcgcaaacgctggagcgctaa

DBGET integrated database retrieval system