KEGG   Idiomarina loihiensis GSL 199: K734_03605Help
Entry
K734_03605        CDS       T02681                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ili  Idiomarina loihiensis GSL 199
Pathway
ili00350  Tyrosine metabolism
ili00643  Styrene degradation
ili01100  Metabolic pathways
ili01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ili00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    K734_03605
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    K734_03605
Enzymes [BR:ili01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     K734_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGM35588
LinkDB All DBs
Position
complement(777031..777669)
Genome map
AA seq 212 aa AA seqDB search
MKLYGYWRSSASYRVRIALNLKGLAYEYEPVHLVKDGGQQHSEAYRKLNPARLVPTFIDG
DVRLNQSLAIIEYLEECYPKKPLLPSAPADKARVRALAYDLACELQPVTNLRVLQYLTGE
LNCSDEQRSAWIANWVERSFTAFEQRLTEYAGDYCYGNSVTLADICLIPQVYNAQRFNLD
LTAYPTLMAVHERLQALDAVQQARPENQADAQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacggctactggcgctcaagcgccagttaccgggttcgtattgcgttaaac
ctcaaagggctggcgtacgagtacgaaccggtgcatttagttaaagacggcggacaacag
cacagtgaggcttatcgaaagcttaatcctgcgcgcttggttcctacttttatagatggt
gacgttaggttaaatcagtctttagccattattgagtatctggaagagtgctatccaaag
aaacctttattgccctccgctccagctgacaaagccagagtcagagccttggcttatgat
ttagcctgcgaactgcaacctgttacaaacttacgagtgctacagtacttaaccggtgag
ctgaattgcagtgacgaacaacgttcagcctggatagctaactgggtagaacgaagtttt
accgcatttgaacagcggcttaccgagtatgcaggtgattattgctatggtaattcggta
acattggctgatatctgtttgatacctcaggtatacaatgcacaacgctttaatttggac
ttaacggcatatccaactttaatggcggtgcatgaacgtttgcaggcgcttgacgcagtg
caacaggctcggcctgaaaatcaagcggatgcacagtaa

DBGET integrated database retrieval system